KEGG   Neosartorya fischeri: NFIA_085980Help
Entry
NFIA_085980       CDS       T01070                                 

Definition
serine/threonine protein kinase (YPK1), putative
Orthology
K13303  
serum/glucocorticoid-regulated kinase 2 [EC:2.7.11.1]
Organism
nfi  Neosartorya fischeri
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 637 aa AA seqDB search
MSWKLTKKLKETHLAPLTNTFTRSSSTSTIKGESGEETPVVSQTPSISSTNSNGINASES
LVSPPVDPVKPGILIVTLHEGRGFALSPHFQQVFTSHFQNNNYSSSVRPSSSSSHSTHGQ
TASFAQSGRPQSTSGGINAAPTIHGRYSTKYLPYALLDFEKNQVFVDAVSGTPENPLWAG
DNTAFKFDVSRKTELNVQLYLRNPSARPGAGRSEDIFLGAVRVLPRFEEAQPYVDDPKLS
KKDNQKAAAAHANNERHLGQLGAEWLDLQFGTGSIKIGVSFVENKQRSLKLEDFDLLKVV
GKGSFGKVMQVMKKDTGRIYALKTIRKAHIISRSEVTHTLAERSVLAQINNPFIVPLKFS
FQSPEKLYLVLAFVNGGELFHHLQREQRFDINRARFYTAELLCALECLHGFKVIYRDLKP
ENILLDYTGHIALCDFGLCKLDMKDEDRTNTFCGTPEYLAPELLLGNGYTKTVDWWTLGV
LLYEMLTGLPPFYDENTNDMYRKILQEPLTFPSSDIVPPAARDLLTRLLDRDPQRRLGAN
GAAEIKSHHFFANIDWRKLLQRKYEPSFRPNVMGASDTTNFDTEFTSEAPQDSYVDGPVL
SQTMQQQFAGWSYNRPVAGLGDAGGSVKDPSFGSIPE
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggaagctcactaaaaagttgaaggaaacgcatcttgcgcctctgacaaacacc
tttacccgctcatcctccacatccaccatcaaaggtgaatccggcgaagagactccggta
gtttcgcagactccgagtatttcatccacaaactccaacggaatcaatgcctcggagtcg
ctcgtttcaccacctgtcgaccctgtcaagcctggtatcttgatagtcactcttcatgaa
gggcgaggcttcgccctgtcccctcatttccagcaggttttcacttcgcacttccagaac
aacaactattcgagttcagtccgtcccagctcctcttcctcccactctacccatggacaa
acggcttcgttcgcgcaaagcggccgcccgcagtctaccagcggtggcatcaatgctgct
ccaaccatccacggtcgctactcgaccaagtacctcccctacgctcttctggattttgag
aagaaccaggtttttgtcgacgctgtttcgggtacacctgagaatcctctctgggccggc
gataacaccgcattcaagttcgatgtgtctcgcaagaccgaactgaacgtccagctgtat
cttcgcaatccgtcagctcgacctggtgccggtcggagcgaggatatcttcctcggtgcg
gtcagagttctccctcggtttgaagaagcccaaccgtatgtggacgatccgaagctcagc
aagaaggataatcagaaggcagccgcggctcatgcaaataacgaacgtcacttgggccag
ttaggcgcagagtggctcgaccttcagttcggtacgggatcaatcaagattggggtctcc
tttgttgagaacaagcagcgcagtttgaagctggaggactttgacctgctgaaggttgtg
ggtaagggtagttttggcaaggtgatgcaagtcatgaagaaagacactggtcgaatctac
gctctcaagaccattcgtaaggcccatatcatctcgcgatcggaagtcacacacaccctg
gcggagcggtccgtgcttgcccagatcaacaacccttttatcgttcccctgaagttctcg
ttccagtctcccgagaagctgtacttggttctcgctttcgtcaatggcggagagttgttc
caccacctccagcgggagcagcggttcgatatcaaccgagctcgtttctacacggctgag
ttactctgtgcgctggaatgcctgcatggcttcaaggtcatctatcgtgatttgaagccc
gaaaacatcctgcttgattacaccggccacattgcactttgtgactttggtctgtgcaag
ttggacatgaaggacgaagatcggacgaacactttttgtggaactcctgaatatcttgcg
cctgagctcttgcttggcaacggttacacgaagactgtcgactggtggactctgggtgtc
cttctctacgagatgttaactggtcttccaccgttttatgacgagaacacgaacgacatg
tatcggaagattttacaagagcccctgactttccccagcagcgacattgttcctccggcc
gctcgtgaccttctgacaaggctgcttgatcgtgatcctcagcgtcgccttggcgcaaac
ggcgccgcagagatcaagtcgcaccatttcttcgccaatattgattggagaaagcttctt
cagaggaagtatgagccaagtttccggccgaatgtgatgggcgcatctgataccaccaac
ttcgacacggaattcacttcggaggcaccccaggactcgtatgtcgatgggcctgttctg
tcacagacaatgcagcagcagtttgcgggctggtcttacaacaggcctgtcgctggtctt
ggagatgctggtggcagtgtcaaggatccatccttcggcagcattcctgagtga

DBGET integrated database retrieval system