KEGG   Neosartorya fischeri: NFIA_086240Help
Entry
NFIA_086240       CDS       T01070                                 

Definition
enoyl-CoA hydratase/isomerase family protein
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
nfi  Neosartorya fischeri
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:nfi01200]
Metabolism; Overview; Fatty acid metabolism [PATH:nfi01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:nfi00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:nfi00650]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:nfi00062]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:nfi00071]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:nfi00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:nfi00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:nfi00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:nfi00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 294 aa AA seqDB search
MFSRQCSRLVSSRTAIPLTSYLSRVARPYSSAAPMYEYILTSTPKPGVGLITLNRPKALN
ALSSPLFKELNDALSKYEEDKDIGAVVITGSEKAFAAGADIKEMAPLTFSNAYTNNFIAP
WSHLANSVRKPVIAAVSGYALGGGCELALMCDIIYCTASATFGQPEIKLGVIPGAGGSQR
LTHAVGKSKAMELILTGKNFSGKEAEQWGVAAKAVEGGHEELLAEALKTAETIAGYSRVS
VLAAKEVVNKSQELSLREGVEYERRLFHGLFGSKDQKIGMTAFAEKKKPEWSHE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgttctctcggcaatgttcccgcctggtctcgtccaggaccgctatccctcttacatcc
taccttagccgtgttgccagaccctactcatccgctgccccgatgtacgaatacatcctc
acgtcgactcctaagcctggtgttggactgatcaccctcaaccgccccaaggcactcaac
gccctctccagcccgctcttcaaggaactcaacgatgcactatctaaatacgaggaagat
aaagacatcggagccgtcgtcatcacaggcagcgaaaaggcctttgccgccggcgccgac
atcaaggaaatggccccactgaccttctcaaacgcctacaccaacaacttcatcgccccg
tggtcgcacctcgccaactccgtccgcaagcccgtcatcgccgccgtctccggctacgcc
ctcggcggcggctgcgagctcgccctcatgtgcgacatcatctactgcaccgccagcgcc
accttcgggcagcccgagatcaagctgggcgtgatccccggcgcgggcggctcgcagcgc
ctcacccacgccgtcggcaagagcaaggcgatggagctgatcctgacggggaagaacttc
agcggcaaggaggcggagcagtggggtgttgcggccaaggctgtcgagggtgggcacgag
gagctactggccgaggcgcttaagactgcggagacgattgcgggatatagtcgggtgagt
gtactggctgccaaggaagtggtgaataaaagccaggagctttcgctcagggagggcgtg
gagtatgagaggcggttgttccatggcttgtttggaagcaaggatcagaagattggaatg
actgcgtttgctgagaagaagaagcccgagtggtctcatgagtag

DBGET integrated database retrieval system