KEGG   Aspergillus fischeri: NFIA_086320Help
Entry
NFIA_086320       CDS       T01070                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00010  Glycolysis / Gluconeogenesis
nfi00051  Fructose and mannose metabolism
nfi00562  Inositol phosphate metabolism
nfi01100  Metabolic pathways
nfi01110  Biosynthesis of secondary metabolites
nfi01130  Biosynthesis of antibiotics
nfi01200  Carbon metabolism
nfi01230  Biosynthesis of amino acids
Module
nfi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nfi_M00002  Glycolysis, core module involving three-carbon compounds
nfi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NFIA_086320
   00051 Fructose and mannose metabolism
    NFIA_086320
   00562 Inositol phosphate metabolism
    NFIA_086320
Enzymes [BR:nfi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NFIA_086320
Exosome [BR:nfi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NFIA_086320
  Exosomal proteins of bladder cancer cells
   NFIA_086320
  Exosomal proteins of melanoma cells
   NFIA_086320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 4587132
NCBI-ProteinID: XP_001260574
UniProt: A1DH20
AA seq 285 aa AA seqDB search
MATTKTPFPPLPKTLLIISLKMYFTPDRTLSYLRDLLSPTNKIVLPQNRSRLLLALIPDF
LTIYPCAQIIKDWAAGFHLPSDFNPEPPFLLGAQDCFWEAAGAYTGEVSPASLRSLGVRL
VELGHAERRALFGETDDQVARKAAAAVDQGLIPLVCIGEVTAPGAIASEAVGLAVRECAG
QMRAVLDAIPSAAPVIFAYEPVWAIGKAKPAGVDHVAAVVEGIRAVIGERVGEVRVLYGG
SAGPGLWGAGGLGKAVDGMFLGRFAHEIDGVKKVVQEVEETLSEQ
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggccaccacaaagacacccttccctcccctccccaaaaccctcctcatcatctccctc
aaaatgtacttcacccccgaccgcaccctctcctacctacgcgacctcctaagcccaacg
aacaaaatcgtcctcccccaaaaccgctccaggctcctcctagccctcatccccgatttt
ctaacgatctacccctgcgcccaaatcatcaaagactgggccgccggcttccacctcccc
tccgacttcaaccctgaaccacctttccttctcggcgcccaggactgcttctgggaggcc
gcaggcgcctacacaggcgaggtctcccccgcctcgctgcgttcgctgggggtccggcta
gtcgagctcggccacgctgagcgccgcgctctctttggcgagacggacgaccaggtagcc
cgcaaggcggctgctgctgttgaccagggcctgatcccccttgtttgcatcggggaggtt
accgcgccgggggcgatcgcgtcagaggcggtggggctggcggtgcgtgagtgtgcgggg
cagatgcgcgcggtgctggatgcgatcccctccgcggcgccggttatctttgcgtatgag
cctgtttgggcgattgggaaggcgaagcctgctggggtggaccatgttgcggctgtagtg
gaggggatacgggcggtgattggggagcgggtgggggaggtgagggtgttgtatgggggg
agcgcggggccggggttgtggggggctggagggctgggcaaggccgttgatgggatgttt
ctggggaggtttgcgcatgagattgatggtgtcaaaaaggtggtccaggaggtggaggag
acgttgtcagagcaatag

DBGET integrated database retrieval system