KEGG   Neosartorya fischeri: NFIA_087120Help
Entry
NFIA_087120       CDS       T01070                                 

Definition
pyruvate dehydrogenase kinase
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
nfi  Neosartorya fischeri
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 434 aa AA seqDB search
MWKPSERLMETIRHYASFPATGVSLRQMVQFGDRPSTGTLFRASQFLSEELPIRLAHRVQ
DLGELPDGLSEMPSIKKVQDWYAQSFEEIINLPRPTLSQEVKARLLRPGKMNGGFSKILS
ETTQNPSIKEGQYRSSPTNGNGNGKGHVSRRYFYPSDDQGHWPPELNDYNQRFAKTLQHI
KRRHDSVVTTVAQGILEWKRKRQRLQIDSTVQSFLDRFYMSRIGIRMLIGQHIALTEQTH
VRHPNYVGIICTKTNVREVALEAIDNARFVCEDYYGLFEAPKIQLICKDDLNFMYVPGHL
SHMLFETLKNSLRAVVETHGADKEAFPVTKVIVAEGKEDITIKISDEGGGIPRSSIPLVW
TYMYTTVDQTPNLDPDFDKNDFKAPMAGFGYGLPISRLYARYFGGDLKLISMEGYGTDVY
LHLNRLSSSSEPLQ
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaaccgtcggagagactgatggaaaccatcagacactatgcgagcttccccgcc
acaggtgtctctctccggcagatggtccagttcggtgacaggccatcgacaggaaccctc
tttcgtgcctctcaatttctctccgaagagttacctattcgcttagcacatcgcgttcag
gatcttggagaacttcctgatggattgagtgaaatgccatcgatcaagaaggtgcaggac
tggtatgcgcagtcgttcgaggaaatcatcaacctgccccgaccaactctttcccaagaa
gtcaaagctcgcctcttacggcctgggaagatgaatggcggcttttctaaaattctttct
gaaactacacagaatcccagcatcaaggaagggcagtatcggtcctcccccacgaacggg
aatggaaacgggaaggggcatgtcagccgaagatacttctacccatccgatgaccaaggc
cattggccacccgaattgaacgactacaaccaacggtttgcgaagactctgcagcatatc
aaacggcgacacgacagcgtcgtgaccaccgtagcccagggcattttggaatggaagcga
aaacgccaacgtttacagattgattctaccgtccagtcattcctagatcgcttttatatg
tcccgtattggtatacgaatgttaatcggtcaacacatcgccctgacggagcaaacgcat
gttcgccacccgaactacgtcggtatcatttgcaccaagacaaatgttcgagaagtcgca
ctcgaggccattgacaatgctcgttttgtctgtgaggactactatggtcttttcgaagca
ccgaagattcagctcatctgcaaggacgacctcaacttcatgtacgttcccggtcacctg
tcacacatgctctttgagactctcaagaactcgctgcgtgctgtggtggagacccatggc
gcggacaaggaagcattccctgtgacaaaggtcattgtggccgaaggaaaggaggacatc
accatcaaaatctctgatgaaggtggtggcataccccgttcttccatcccgttggtgtgg
acatacatgtacactaccgtggatcagacgcccaatctggatccggatttcgataagaac
gacttcaaagctcccatggctggctttgggtacggattgcctatcagtcgcttgtacgct
cggtactttggtggtgatctcaagttgatcagtatggaaggatatggcacagatgtctat
ctccatctgaatcggctctcttcgagctcggagcccctgcaatga

DBGET integrated database retrieval system