KEGG   Neosartorya fischeri: NFIA_087380Help
Entry
NFIA_087380       CDS       T01070                                 

Definition
cAMP-dependent protein kinase catalytic subunit PkaC1
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
nfi  Neosartorya fischeri
Pathway
Meiosis - yeast
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    NFIA_087380
Enzymes [BR:nfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     NFIA_087380
Protein kinases [BR:nfi01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   NFIA_087380
Messenger RNA biogenesis [BR:nfi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     NFIA_087380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 490 aa AA seqDB search
MPTLGGLLKKRRTKDSHTLSKELESSSSPTAAQTQTSPNSADHDHHNQHNDQTHHHQHSA
SSNTSNNSATPSAAQLHRSSNDNPNRSSGTDQNSEGPTASMQSAVTQPHPSTHHNSGLHH
LQHQQQQPQQQHSHTSRLHNILHPSHHASQASAEGYANSQQANRAEARTTKGKYSLDDFT
IQRTLGTGSFGRVHLVQSKHNHRFYAIKVLKKAQVVKMKQVEHTNDERRMLNRVRHPFLI
TLWGTWQDARNLYMVMDFVEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHSQQIIY
RDLKPENLLLDRHGHLKITDFGFAKEVPDITWTLCGTPDYLAPEVVSSKGYNKSVDWWSL
GILIFEMLCGFTPFWDSGSPVKIYENILRGRVKYPPYLHPDAVDLLSQLITADLTKRLGN
LHGGSEDVKNHPWFAEVTWDRLARKDIDAPYVPPIRGGQGDASQYDRYPEETEQYGQQGE
DVHGHLFPDF
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgccgactttaggaggtctcttgaagaaacggcggacgaaggattcgcataccctctcc
aaagaactggaatcaagttcgtcacccacagcggcccagacacagacgtcacccaactct
gccgaccacgaccaccacaaccagcacaacgatcaaacccaccatcatcaacattcggcc
agcagtaacaccagcaataattccgcaactccctctgctgctcagcttcatcgctcatcc
aacgacaaccccaatcgctcttcaggtacagatcaaaattccgagggtccaactgcctcc
atgcaatccgccgtgacgcaaccccatccctccacccaccacaactcaggcctccaccac
ctacaacaccagcaacaacagccacaacaacaacactcccatacctctaggttacacaat
atacttcacccctctcatcatgcgtcacaggcttctgccgaaggttatgcaaactcccag
caggccaatcgggctgaagcccgcactacaaaagggaaatattccctagacgatttcact
atccaacgtacactaggtaccggtagtttcggtcgtgtccatttggtgcagtcgaaacac
aatcatcgcttctatgcgatcaaggtcctgaagaaggcgcaggtggtcaagatgaaacag
gtcgagcatacaaatgacgagcgacgaatgctcaatcgtgtcaggcatccattcctgatc
acattgtggggtacctggcaagacgcaaggaatctgtacatggtaatggactttgtggag
ggtggagagctctttagtttacttcgcaaatctcagcggttcccaaaccctgtcgccaag
ttctatgcggccgaggtgactcttgcactggagtatctacactctcagcagattatttac
cgggacctgaagcctgagaatctgctactagaccggcacggtcatctgaagatcaccgat
tttgggttcgcgaaggaggtacctgatatcacatggactctttgcggaacgcccgattat
cttgctccagaagttgtttcgtccaagggatataacaaatcggttgattggtggtcactt
ggaattcttatcttcgaaatgttgtgcggcttcacacccttctgggacagtggctctccc
gtcaagatctacgagaacattctccgcggtcgtgtcaagtacccgccctaccttcacccg
gacgccgtcgacttgctctcgcagctcatcacagcggatttgaccaagcgactgggcaac
cttcatggaggttccgaagatgtgaagaaccacccttggttcgcggaagtcacctgggat
cgtcttgcaagaaaggacattgatgctccttatgttcctcctatccgtggaggtcagggt
gatgccagtcaatacgatcggtatcccgaggagactgaacaatacggccagcagggcgaa
gatgtgcatggccatcttttccccgacttctag

DBGET integrated database retrieval system