KEGG   Aspergillus fischeri: NFIA_087380Help
Entry
NFIA_087380       CDS       T01070                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit PkaC1
Organism
nfi  Aspergillus fischeri
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 490 aa AA seqDB search
MPTLGGLLKKRRTKDSHTLSKELESSSSPTAAQTQTSPNSADHDHHNQHNDQTHHHQHSA
SSNTSNNSATPSAAQLHRSSNDNPNRSSGTDQNSEGPTASMQSAVTQPHPSTHHNSGLHH
LQHQQQQPQQQHSHTSRLHNILHPSHHASQASAEGYANSQQANRAEARTTKGKYSLDDFT
IQRTLGTGSFGRVHLVQSKHNHRFYAIKVLKKAQVVKMKQVEHTNDERRMLNRVRHPFLI
TLWGTWQDARNLYMVMDFVEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHSQQIIY
RDLKPENLLLDRHGHLKITDFGFAKEVPDITWTLCGTPDYLAPEVVSSKGYNKSVDWWSL
GILIFEMLCGFTPFWDSGSPVKIYENILRGRVKYPPYLHPDAVDLLSQLITADLTKRLGN
LHGGSEDVKNHPWFAEVTWDRLARKDIDAPYVPPIRGGQGDASQYDRYPEETEQYGQQGE
DVHGHLFPDF
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgccgactttaggaggtctcttgaagaaacggcggacgaaggattcgcataccctctcc
aaagaactggaatcaagttcgtcacccacagcggcccagacacagacgtcacccaactct
gccgaccacgaccaccacaaccagcacaacgatcaaacccaccatcatcaacattcggcc
agcagtaacaccagcaataattccgcaactccctctgctgctcagcttcatcgctcatcc
aacgacaaccccaatcgctcttcaggtacagatcaaaattccgagggtccaactgcctcc
atgcaatccgccgtgacgcaaccccatccctccacccaccacaactcaggcctccaccac
ctacaacaccagcaacaacagccacaacaacaacactcccatacctctaggttacacaat
atacttcacccctctcatcatgcgtcacaggcttctgccgaaggttatgcaaactcccag
caggccaatcgggctgaagcccgcactacaaaagggaaatattccctagacgatttcact
atccaacgtacactaggtaccggtagtttcggtcgtgtccatttggtgcagtcgaaacac
aatcatcgcttctatgcgatcaaggtcctgaagaaggcgcaggtggtcaagatgaaacag
gtcgagcatacaaatgacgagcgacgaatgctcaatcgtgtcaggcatccattcctgatc
acattgtggggtacctggcaagacgcaaggaatctgtacatggtaatggactttgtggag
ggtggagagctctttagtttacttcgcaaatctcagcggttcccaaaccctgtcgccaag
ttctatgcggccgaggtgactcttgcactggagtatctacactctcagcagattatttac
cgggacctgaagcctgagaatctgctactagaccggcacggtcatctgaagatcaccgat
tttgggttcgcgaaggaggtacctgatatcacatggactctttgcggaacgcccgattat
cttgctccagaagttgtttcgtccaagggatataacaaatcggttgattggtggtcactt
ggaattcttatcttcgaaatgttgtgcggcttcacacccttctgggacagtggctctccc
gtcaagatctacgagaacattctccgcggtcgtgtcaagtacccgccctaccttcacccg
gacgccgtcgacttgctctcgcagctcatcacagcggatttgaccaagcgactgggcaac
cttcatggaggttccgaagatgtgaagaaccacccttggttcgcggaagtcacctgggat
cgtcttgcaagaaaggacattgatgctccttatgttcctcctatccgtggaggtcagggt
gatgccagtcaatacgatcggtatcccgaggagactgaacaatacggccagcagggcgaa
gatgtgcatggccatcttttccccgacttctag

DBGET integrated database retrieval system