KEGG   Aspergillus fischeri: NFIA_088290Help
Entry
NFIA_088290       CDS       T01070                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
nfi  Aspergillus fischeri
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 4587328
NCBI-ProteinID: XP_001260770
UniProt: A1DHL6
AA seq 180 aa AA seqDB search
MGKDEGFAPGDAKKGAKLFQTRCAQCHTVESGGSHKVGPNLHGLFGRKTGSAEGYAYTDA
NKQAGVTWDENTLFSYLENPKKFIPGTKMAFGGLKKGKERNDLITYVLLPKAHSAMVGIA
GANCFSPTATSRRTAKHVRPEKSLVSSTLSGKLCRADPPVVKADARQVQRTRHVLYYNLV
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggacgaaggcttcgctcctggtgacgctaagaagggtgccaagctcttccag
acccgttgcgctcagtgccacactgtcgagtctggcggttcccacaaggtcggccccaac
ctccacggtctcttcggccgtaagaccggttccgccgagggatacgcctacaccgacgcc
aacaagcaggccggtgttacctgggacgagaacactctgttctcctaccttgagaacccc
aagaagttcatccccggtaccaagatggccttcggtggtctgaagaagggcaaggaaagg
aacgacctgatcacgtatgtgcttttgccgaaggctcactctgccatggttggcattgca
ggcgctaactgtttctctcctacagctacctcaaggagaactgctaaacatgttcgccct
gaaaagtcacttgtctcttcgaccttgtctgggaaactttgtcgcgccgatcctcctgtg
gtaaaagcagatgcacggcaagttcaacggacacggcatgtactatactacaaccttgtt
taa

DBGET integrated database retrieval system