KEGG   Neosartorya fischeri: NFIA_088290Help
Entry
NFIA_088290       CDS       T01070                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
nfi  Neosartorya fischeri
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    NFIA_088290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 180 aa AA seqDB search
MGKDEGFAPGDAKKGAKLFQTRCAQCHTVESGGSHKVGPNLHGLFGRKTGSAEGYAYTDA
NKQAGVTWDENTLFSYLENPKKFIPGTKMAFGGLKKGKERNDLITYVLLPKAHSAMVGIA
GANCFSPTATSRRTAKHVRPEKSLVSSTLSGKLCRADPPVVKADARQVQRTRHVLYYNLV
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggacgaaggcttcgctcctggtgacgctaagaagggtgccaagctcttccag
acccgttgcgctcagtgccacactgtcgagtctggcggttcccacaaggtcggccccaac
ctccacggtctcttcggccgtaagaccggttccgccgagggatacgcctacaccgacgcc
aacaagcaggccggtgttacctgggacgagaacactctgttctcctaccttgagaacccc
aagaagttcatccccggtaccaagatggccttcggtggtctgaagaagggcaaggaaagg
aacgacctgatcacgtatgtgcttttgccgaaggctcactctgccatggttggcattgca
ggcgctaactgtttctctcctacagctacctcaaggagaactgctaaacatgttcgccct
gaaaagtcacttgtctcttcgaccttgtctgggaaactttgtcgcgccgatcctcctgtg
gtaaaagcagatgcacggcaagttcaacggacacggcatgtactatactacaaccttgtt
taa

DBGET integrated database retrieval system