KEGG   Aspergillus fischeri: NFIA_088420Help
Entry
NFIA_088420       CDS       T01070                                 

Definition
(RefSeq) bifunctional tryptophan synthase TRPB
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
nfi  Aspergillus fischeri
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NFIA_088420
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NFIA_088420
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NFIA_088420
Enzymes [BR:nfi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NFIA_088420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 722 aa AA seqDB search
MEGIKSTFARCKEQKRAALVAYITAGYPTVEETVDILLGLENGGADIIELGIPFTDPIAD
GPTIQKANTQALANGVTVTTVLNMVRQARSRGLKAPLLLMGYYNPVLRYGEERMLKDCKE
AGVNGFIMVDLPPEEAVRFRDLCSSNGLSYVPLIAPATSESRMKLLCKIADSFIYVVSRM
GVTGATGKLSSNLPELLKRVHQWSGNVPAALGFGVSTREHFLNVQELAEGVVIGSQIITV
LGQAPAGQAAKHAEEYLSSVTGRKLERDAQGILTDEINVLEAVEKAQAPAVSQPTAVVTE
ADTPAGPGLADQIDALNGTGNPAAQPSRFGEFGGQYVPESLMDCLAELERGFQEALNDPK
FWEEFRSYYPYMGRPSSLHLANRLTEYVGGANIWLKREDLNHTGSHKINNALGQILIARR
LGKTRIIAETGAGQHGVATATVCAKFGMKCVVYMGAEDVRRQALNVFRMKLLGASVVAVD
AGSRTLRDAVNEALRAWVVDLDTTHYIIGSAIGPHPFPTIVRTFQSVIGEETKQQMMEAI
GKLPDAVVACVGGGSNAVGMFYPFAKDTSVKLVGVEAGGDGIDTNRHSATLTGGSKGVLH
GVRTYVLQDEHGQISETHSISAGLDYPGVGPELSSWKDSDRARFIAATDAEALIGFRTLA
QTEGIIPALESSHAVWGAMELAKSMKTGDIVLNLSGRGDKDVQSVADELPRLGPQIGWDL
RF
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaatcaagagcacttttgccaggtgcaaagagcagaagcgcgcagcactcgta
gcatacatcacagccggctatcccaccgtcgaggagacagttgacattctcctgggacta
gaaaatggaggcgcagatatcatcgaactgggcattcccttcacagatcccatcgcagat
ggccccaccattcagaaggccaacacccaggctctggccaatggcgtcacggtcaccaca
gtgctgaacatggtccgtcaagctagaagcagaggcctcaaggccccgctgcttctgatg
ggttactataaccctgtcttgcggtatggtgaggagcgtatgctcaaggattgcaaggag
gctggtgtcaatgggttcatcatggtcgatcttcctcccgaagaggcggtgcggttcaga
gatctgtgttctagcaatggactgtcttatgtcccgcttatcgctcctgctacctccgag
tcccgtatgaagctgctctgcaagatcgccgattctttcatctacgtcgtttcgagaatg
ggtgtcaccggcgcgacgggaaagctgagctcgaacctccccgagctcctgaagcgcgtt
caccagtggtcggggaacgtgcccgctgctctgggcttcggtgtcagcacccgtgagcac
ttcttgaatgtgcaggaactcgccgagggtgttgtcattggtagtcagattatcactgtc
ctgggccaggcccctgccggtcaggcggctaagcacgccgaggagtacttgtcgagtgtc
actggccgcaagctcgagagagatgcacagggtatcctgactgatgagatcaacgtgttg
gaggccgtggagaaggcccaggcaccggctgtctcgcagcctaccgctgttgttaccgag
gccgatactcctgccggtcctggattggccgaccagatcgacgctctcaatggaactggt
aaccctgctgctcagccatcgcgcttcggtgaatttggtggacagtacgtccccgagtct
ctcatggactgcttggccgagctcgagcgcggcttccaagaagctctgaatgaccccaag
ttctgggaggagttccgctcttactacccatacatgggtagacccagcagcctgcacctg
gccaatcgcctcactgaatatgtaggaggtgccaacatttggctcaagcgcgaggatctc
aaccatactggcagtcacaaaatcaacaacgctcttggtcagattctcatcgctcggaga
ctgggcaagaccagaatcatcgctgaaaccggtgctggacaacacggtgtcgccacggcc
actgtatgtgcgaagttcggcatgaagtgtgtggtgtacatgggtgctgaggatgtccgc
cggcaagccctgaacgtcttccggatgaagctccttggagcctccgtcgtggccgtcgat
gccggaagcaggactctgcgtgatgctgtcaacgaggcccttcgtgcctgggttgttgac
ctggacaccactcactacattatcggttccgccattggacctcatcccttccccaccatc
gtgcgtaccttccagtccgtcatcggcgaggaaaccaagcagcagatgatggaggccatc
ggcaaactccccgatgccgtcgtcgcttgtgtcggcggtggcagcaatgccgtcggcatg
ttctaccccttcgccaaggacaccagcgtcaagttggtcggcgtcgaggccggaggcgac
ggtatcgacacaaacagacactcggcgaccctgaccggcggcagcaagggcgtgctgcac
ggtgttcgcacctacgtcctccaggacgaacacggccagatctccgagacccactccatc
tccgccggcctggactaccccggtgtcggccccgaactcagctcctggaaggacagcgac
cgcgcccgcttcatcgctgccaccgacgccgaggccctgatcggcttccgcaccctcgcg
cagaccgagggcatcatccccgccctggagtcctcgcacgccgtctggggcgctatggaa
ctcgccaagtccatgaagaccggcgacatcgtcctgaacctgagcggcagaggagacaag
gacgtccagagcgtcgcggacgaactaccccgtctgggtccccagatcggctgggacctg
cggttctaa

DBGET integrated database retrieval system