KEGG   Neosartorya fischeri: NFIA_089310Help
Entry
NFIA_089310       CDS       T01070                                 

Definition
ubiquitin carboxyl-terminal hydrolase, putative
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
nfi  Neosartorya fischeri
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1658 aa AA seqDB search
MNQSSSVSSIVIPLILHHLKNTIEEARDSRRPRLVFICWFIFKTPVRSLSSNHHLLACLF
NRPFIVLPRAATRRAQLTVTTSSTKRRKVAEPRRPGGALPGLSFASQAGRRHSQHPPSDS
SSVPPNPRPSSTSGSNRSRSPSVSPSPRYIPAHLQEEVLGTAARSPTPESASSTADYPSI
ACAGLTLHSDTMTDMSGSDKRDGSVPSTGGDVRSSSPGIKRSAPNTDQDVEMDLGSTEKR
SVSLSQHTDAMDMTTAEGNSNGNGDNSGSDNVYPTPSSMSTFTAPTATRKESKAQASISS
HDLPPIDDQVAQVTCTMAQPLKEKQKGYLVSMSWLKRVLARSSTHADKADKSAAEGEIGP
VDNSDLVLVTDPAITGFHDEAGEPFVPLRPGLQMGEDFEIVPQEGWDLIMRWYGLASQSP
AIVRYAHNTVEEGDAQNIQYELHPPIFTVLKLANPAAGTTPQSLREKNMSPAKVLSSRHT
NFQKWLKQVKGLANIDMSTKVRVWRILGGLGSATASAAITPAASRSASPAPTASLVANAG
NNLVLDLNTFLSLSDGAQRELVDNVKDQTNNPNFNGRSTLDRVGLSTSDVVVLEERVGGE
WASEASKKTLDRLGVPSGSVKNGAPAKLKNKSPTNSGRSSPAPEPIRGRRKDGKPRGCTG
LSNLGNTCYMNSALQCVRSVEELTYYFLNDVYKRDLNPSNPLAHNGDIAKAYANLLRMLY
DEAGQSSFAPRQFKHTIGRYGPAFSGYGQQDSQEFLLFLLDGLQEDLNRIQKKPYIEKPD
STDDMVHDKEALKEFANKCWDIYKARNDSVITDLFAGMYKSTLVCPVCEKVSIIFDPFNN
LTLQLPIENLWSKEIFFFPLHRKPVIVDVEIDKNASIKALKELVAKKMGSDPQRLVMAEI
YKCKFYKMFDNSASIADCQIGQGDDIAIFEVESVPTNYNPDKRQKSYFSYGRSDYEEIPS
FDSPKADRMLVPIFNRHCRPKSNNSGNMQRSLFGAPLYVIISREEAQNYDAILRKVLEAV
ATLTTRDILNEANIKKADEQGGTQEDSDTVVMNEDDAHSADSKIKTSSVDGEDGLVDVSM
RDASDEADTPSPQDIKCENADSSPGSSIAPGLRSLFDMKIIKSSHEVVPLGWSSVDDIKD
YPLMSSRVKAQSASKQKTTSGTVTDRKTSDDSDQDGSAGSASDSDSDMFSNISRPKAVKT
QTDERPLIRPGEGIVLDWNDQAHDALFGGDKKDTDGLRGSPTWTNVERIPDPELAKRRDL
RRSRKKRGVTLYECLDEFNKEEILSENDAWYCPRCKEHRRASKKFELWKTPDILVMHLKR
FSASRGFRDKLDVLVDFPVEGLDMSGRVESPEEGKSLIYDLFAVDNHYGGLGGGHYTAYA
KNFMSGEWNEYNDSSVSRPIDPQSVVTPAAYLLFYRRRSDRPLGGKILEEITESSTSTRP
ASEDNSPAGSRGQSPSGNGRRLGGSSRNGSSSALAGVGAAHQAGDGGLRTGIRARNEDSD
DDDESPPDYSDSPAAGEQSLAKANRLEGMSFDEDEFGDGAYANPLPYSSQPTWSFDRVTD
AHGLSQMTTVPPGSISDDEDLFDDDASNKAVGGGDLSDSDLRLAALTGSPIGQGVFPGTP
MEEEAPIQDIPPPLDGDDGEDLPVVELRVNDDDQIVSD
NT seq 4977 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaatcttcgtctgtttcttctattgttattcctcttattctgcatcatctgaag
aacacaatagaggaagccagagactcaagacgaccacgactcgttttcatatgctggttt
atttttaaaactccagttaggtcattatcatcaaatcatcacctactggcctgccttttt
aatcgaccatttatcgtgttacccagagctgccacgagacgtgcgcagctcaccgtcacg
acgtcttccacaaagcgccgtaaggttgcagagcctcgcagaccaggaggagcccttccg
ggtttgtcgtttgcctcgcaggctggaagacgtcacagtcagcaccccccttccgactcg
tcttccgtgccaccaaatcctcgcccatcgtctacgtccgggtcgaaccgaagtcgaagc
ccttctgtgtccccgtctcctcgctacattcccgcccatttgcaggaagaagtgcttggc
accgccgcccgctccccgaccccggaatccgccagtagtaccgctgactatccttcgatc
gcctgcgcaggactcaccctacacagcgacactatgacggatatgtctggttccgacaaa
agagatggcagcgttccgtctactggaggtgacgttcggtcatcctcccccggtatcaaa
cggtcggctcctaacaccgaccaggatgtggagatggatctaggttcgacggagaagaga
tctgtatctctatcccagcacacagacgcgatggatatgaccacggcggagggaaactcg
aacggcaacggtgacaactctgggtcagacaacgtctatcccacaccatccagcatgtcg
acctttaccgcccccacggcgacccgaaaggaatccaaggcccaagcctccatctcgtcc
catgatctccctcctatcgacgaccaagtcgctcaagtgacctgcaccatggcccagccg
ttgaaggagaaacagaagggatatctggtatccatgtcttggctgaagcgggtgctcgct
cgcagctcgacccacgccgacaaggcagataagtcggcagctgaaggagaaattggaccc
gtggataactcagacctcgtgctggtcacagacccagcgatcaccggcttccatgatgag
gcaggagagccctttgtgcccctgcgtccaggtctgcagatgggagaggactttgagata
gtgccccaggaaggctgggatttgatcatgcgatggtacggcttggctagtcaatcgcca
gccattgttcgctatgctcacaacaccgtggaggaaggtgatgctcaaaatattcaatac
gagctccatccaccaatcttcaccgttctgaagctagcaaacccggccgcggggaccact
ccacagagtctaagagagaagaatatgtcacctgcaaaggtcttgtccagccgacacacc
aacttccaaaagtggctgaagcaagtgaagggactggccaatattgacatgtctaccaaa
gttcgtgtgtggaggatccttgggggactgggaagtgccacggcatcggctgcaatcaca
cccgctgcgtcacggagcgcttctccggcacctacggcctccctggttgccaatgccggc
aacaaccttgtgcttgacctcaatacgttcctctcattatcggacggcgctcagcgagaa
ctggtcgataacgtcaaggatcaaaccaataatcccaatttcaacggtcgatctaccttg
gatcgagttggcttgtctaccagtgatgttgtggtgcttgaggagcgcgttggtggagag
tgggcttcagaagcatccaagaagacgctcgatcgactaggtgttccgagtggcagtgtg
aagaatggcgctcctgccaagctcaagaacaagagtcctaccaacagtggtagatcatct
cccgctccagaacctattaggggccggcgtaaagacggaaagcccaggggctgcacggga
ttgagcaacctcggaaatacctgctacatgaactctgctctacagtgcgtgcgcagtgtg
gaggaactcacatactacttcctgaacgatgtgtataagagagatctcaaccccagtaat
cctctcgcccataacggcgatatagccaaggcgtacgcaaaccttcttcgcatgctctac
gacgaagcgggtcagtcgtcgttcgctccccgccagtttaaacacaccattggtcgttat
ggtccagcattctcgggatacgggcaacaggattcgcaggaatttctgctgttcctgctt
gatgggctgcaagaagatttgaacagaatccagaagaagccatatatcgagaagccagac
tccacggacgacatggtccatgacaaggaggctctcaaagagtttgccaataaatgctgg
gacatttacaaagcccgcaatgactcggtcatcacggatctctttgccggcatgtacaag
tcaactcttgtctgtcctgtctgcgagaaggtcagcatcatctttgatccattcaacaac
ctgacgcttcagcttccgatcgaaaatctttggagcaaggagatcttctttttccctctc
caccgcaagcctgtcatcgttgacgtggaaattgataaaaacgccagcatcaaggcgctc
aaggagttagtagccaagaagatgggctcggatcctcagcgtctcgtcatggccgaaatc
tacaagtgcaagttctacaagatgttcgacaactctgcgtccattgctgattgccagatc
ggccaaggcgatgatatcgcaatcttcgaggttgagtctgttcccaccaactataatccc
gacaagcgccagaagagttacttttcttatggtcgttcagactatgaagaaattccaagc
tttgactcacccaaggcagaccgaatgctagtgcccatcttcaatcggcattgccggcca
aagtcaaataacagcgggaatatgcagaggtcactcttcggcgctcctttgtatgtaatc
atcagcagagaagaggctcaaaactacgatgccatcctccgcaaagttcttgaagctgtt
gccacgttgacaacgcgagacattctcaatgaggcgaacatcaagaaagctgacgagcaa
gggggaactcaagaagattcggataccgttgtgatgaatgaagacgacgcgcattctgca
gattctaaaatcaagacctcatccgtggacggtgaggatggcttggtggacgtttccatg
cgcgacgcttcggacgaggcggatactccatctcctcaagacatcaagtgtgaaaatgct
gactcgagccctggcagctctattgcacctggtcttcggagcctcttcgacatgaagatt
atcaaatcgtcccacgaggttgtgcctctcggctggtcttcagtggacgatatcaaagac
tatccattgatgtcgtccagggtcaaggcacagtcggctagcaaacagaagacaacatcc
ggtacagtgaccgaccgaaaaaccagtgatgactcggatcaggatggaagcgccggcagt
gcttctgacagtgactctgacatgttctccaacatcagtcgccctaaggctgtcaagact
caaaccgacgagcgtcctctgatccgcccgggggaaggtatcgtgctggattggaacgat
caagcccacgatgccctatttggtggggataagaaggacactgacgggctacgtggatct
cctacatggaccaacgtggagcgcattcctgatccggaactcgccaaacgccgtgatctt
cgccggagccggaagaagaggggcgttacactctacgaatgtcttgacgagttcaacaaa
gaggagattctttccgagaatgatgcatggtactgcccccgctgcaaggagcatcgcaga
gccagcaagaaattcgaattgtggaagacccccgacatccttgtcatgcacctgaagaga
ttcagcgccagcaggggtttcagggacaagctggatgtcctggtcgacttccccgttgaa
gggctagacatgagcggccgtgtcgaatcgccggaagagggaaagagcctaatctatgat
cttttcgcggttgataatcactacggtggattaggaggcggtcactatacggcctacgcg
aagaactttatgagtggcgaatggaacgagtacaatgattcgtctgtctcacgaccaatt
gatccccagagtgtggtgactcccgccgcgtatttattgttttaccgtcgacgttcagac
cgcccgctgggcggaaagatcttggaagaaatcaccgagtcgtcaacttcaactcgacca
gccagcgaggacaactccccggctgggtcccgtgggcagtcgccttcggggaacgggcgg
cgtctcggcggctcctcccgcaatgggtcgtcgagcgccttagccggagtcggagcagct
caccaagcgggagatggtggtttgcgaactggaatccgggcgaggaatgaggacagtgat
gacgatgatgaatcgccccccgactattcggacagcccagccgctggcgagcagagcctt
gcgaaagcaaaccgactggaaggtatgagctttgatgaagacgagttcggcgatggagcc
tatgccaacccgctcccctactcaagccaacccacgtggtccttcgaccgagtcacagat
gctcatggcctttcacagatgaccacagtacctccgggatcgatctctgatgacgaggat
ttgttcgacgacgatgccagcaacaaagcggtgggcggcggagatctcagcgactccgac
ttgcgcctcgccgcattgaccggaagcccaatcggtcagggagtgttcccaggcacgccc
atggaggaggaagctccgattcaggacatccctccgccactagacggtgatgacggtgaa
gatttacccgtggtggagctacgggtgaatgatgatgaccagatcgtctcggactga

DBGET integrated database retrieval system