KEGG   Neosartorya fischeri: NFIA_094580Help
Entry
NFIA_094580       CDS       T01070                                 

Definition
melibiase, putative
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
nfi  Neosartorya fischeri
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:nfi00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:nfi00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:nfi00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:nfi00603]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 728 aa AA seqDB search
MAQKSATANAIVVDGKTFALNGYNVSYRFHVDQSTGDLRSDHFGGSVSGPIPDDPAPIIN
GWTGMPDRVRREFPDQGRGDFRVPAIRIRQSQGHTVSAFRYDSHTVVKGKPALSGLPATF
GTEEDVSTLVVHLYDQHSEVAADLMYSIFPKHDAIARSVRITNKGKGTISIEALSSMSVD
LPCEDFDMIGLRGDWAREAHRQRRKVDYGIQGFGSTTGFSSHLHNPFVALAHRFTTESHG
EAWGFSLVYTGSFAAIIEKGSQGLTRVSIGFHPNQLSWPLAPGETLTSPECVSVYSQNGL
GGMSRSLHRLYRNHLVKSKFATDNRPVLLNSWEGLYFDINEENMYRMAQESAALGVKLFV
MDDGWFGDKYPRVSDAAGLGDWVPNPTRFPNGLAPLVKAITSLKVANSSENLRFGIWVEP
EMVNPQSSLYHEHPDWVLHAGSYPRTEQRNQLVLNLALPEVQEFIIDAITDILNSADISY
VKWDHNRAINETPSPAANHAYMLGMYRVFDTLTSRFPDILWEGCASGGGRFDPGILQYFP
QVWTSDDTDAVERIFIQMGTSLVYPASAMGAHISAVPNHQTGRTVPLTFRAHVAMMGGSF
GLELDPLKMRPEEKAAVPELIALAEKVNPIVLKGDMWRLSLPEESNWPAVLFVSEDGAKA
VLFFFQLSPSVNHTMPRVRLQGLDRRAMYSVDEQGPYSGDMLMNLGLQYSFSTDYASKVV
LLERIDVM
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atggctcagaaatcggccactgccaatgctattgtcgtcgacggcaaaaccttcgccctt
aacggctacaatgtttcctaccggttccacgttgaccagagcaccggtgacctgcgctcc
gatcacttcggcggcagcgtcagtggacctattcccgatgatccagctcccataatcaat
gggtggaccggtatgcctgaccgcgttcgccgcgagttcccggaccaaggccggggagac
tttcgagtccctgccattcgcatccgccagtcgcagggacatactgtttcagcttttcgg
tatgattcgcacaccgtggtgaagggcaagcctgcgctgtctggcttgccggcgacattt
ggtacagaggaggatgtctcaacgctggtggtgcatttgtatgaccagcatagcgaggtg
gcagcggatctaatgtattccatatttccaaagcacgatgccattgcgcggagtgtgcgc
atcacgaacaagggtaagggcacgatctcaattgaggcactgtctagtatgagtgtggat
ttaccatgcgaggactttgatatgatcggcctcagaggggactgggcgagagaagcgcat
cggcagaggcgcaaggtggactatggaatacagggatttgggagtacaacaggcttctca
tcccacttgcacaaccccttcgtcgccctggcgcatcgctttactaccgagtcccacggt
gaggcatggggattctcactggtctacaccggctcctttgctgccattattgaaaaaggc
tcgcagggattgacacgtgtatccattggtttccatccaaaccagctatcctggccctta
gctccgggggaaaccctcacgtctcccgagtgcgtatcggtatactcccaaaacggtcta
ggaggcatgtcgcgctctctgcaccgcctgtatcgcaatcaccttgtgaaaagcaagttt
gctacggacaaccgacccgtcttactgaacagctgggaggggttgtatttcgacatcaat
gaggagaacatgtaccgcatggcacaggaatccgctgctttgggtgtaaagctcttcgtc
atggacgacgggtggtttggcgacaaataccctcgagtctcggacgcagcgggtctaggc
gactgggtccccaacccaacacgattccctaatgggctcgcgccgctcgtgaaagccatt
acctccttgaaggtcgccaactcgtcagagaaccttcgcttcggtatctgggttgagccg
gaaatggtgaacccacagtcaagtctataccacgaacaccccgactgggtcctccacgca
ggctcatacccacgcaccgaacaacgcaaccagctcgtcctgaatctcgcgctacccgag
gtacaagagttcatcatcgatgccatcaccgacatccttaacagcgcagacatcagctac
gtaaaatgggaccacaaccgtgctatcaacgagacgccctcccccgccgcaaaccacgca
tacatgcttggaatgtaccgcgtcttcgacaccctcacctctcgcttccccgatatcctc
tgggaaggatgcgcctccggcggcggacgcttcgacccaggaatcctacagtacttcccc
caggtctggacatcagatgacaccgacgccgtggaacgcatcttcatccagatgggtacc
tcgctcgtctaccccgccagcgcaatgggcgcgcatatctccgcggtgccgaaccaccaa
acagggcgaacggtcccgcttacattccgcgcgcacgttgcaatgatgggcggatcgttc
gggcttgagctcgatccgctgaagatgcgccctgaggagaaagctgcggttcccgagctg
atcgcgttggcggagaaggtcaacccgatcgtgctgaaaggcgatatgtggaggcttagt
ctgcctgaggagtcgaattggcctgctgtgctgtttgtctcggaagatggagccaaggct
gtcttgttcttcttccagcttagcccgagtgttaatcataccatgcccagggtgagattg
caggggctggataggcgggcgatgtacagcgttgacgagcaggggccgtattcgggtgat
atgctgatgaaccttggattgcagtattcgtttagcacagattatgctagcaaagtggtg
ctcttggaaaggattgatgtgatgtga

DBGET integrated database retrieval system