KEGG   Neosartorya fischeri: NFIA_096770Help
Entry
NFIA_096770       CDS       T01070                                 

Definition
beta-N-acetylglucosaminidase, putative
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
nfi  Neosartorya fischeri
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:nfi00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:nfi00312]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 931 aa AA seqDB search
MAPKEDMLPPGWEDLDRQMGQLFMMGFDGTSVNPQIRSLIENYHLGSVLLTAKNLKSAEE
ATRLVLELQTIARDAGHPVPLLIALDQENGGVNSLYDEIYIRQFPSAMGIAATGSKSLAH
DVAYATAQELKAVGVNWILGPVLDVLTNVRTQPLGVRTTGDDPQEVSQYGVEFMKGYKKA
GLVTCGKHFPSYGNLEFLGSQTDVPIITESLEQLSLTALVPFRNAIVHGLDSMMVGGVSM
SSAGVNVMHACLSEQVVDDLLRKDLKFNGVVVSECLEMEALTHNIGVGGGTVMAKNAGCD
IILLCRSFPVQQEAINGLKLGVENGIIGRARIEQSLRRVLKMKAKCTSWDQALNPPGLPS
LMQMQPSHTSLSKRAYNNSISVVRDKQNLLPLSNIIEPNEELLLLTPLVKPLPASAVSRS
VTEHMNVSIDPIASDRTASVLSGESVFKELGRSLSRQRSGRVLHTSYTANGVRPIHENLI
DRASAVIVVTADANRNLYQHGFTKHVSLICRSQFTPSGEPREKPMIVIAASSPYDFAMDT
SIGTYVCTYDFTETALEALVKVLYGELTPKGSLPGSISRSQKLHQARQHWLVENWNEERD
AQSLDTLLDAVRADCAQGQRSELLGVTSSSFLLRREEIDEAHFVVRNSSTQALYGFCSTY
FFRSTGTGVIGSLIVDPARRKLSIGNSLHNRAIRTLLQRKGMRRFQLGSRLPGIYLGIPS
SNPVERKRLRQWFANLGWNTALSRPVCSVVLRNLPTWTPPDGLVQGLKNADVSYDLVHGW
DYAEPILDHIKTNSRQGLIDIYKIALGGAPNCGIIRATRPSDGAILGTVVIYNGRSPLAE
HMPVLKATQPSSGGISSPVISPSVGEYATVMQGLILLGIKQIRRQGAEAVVIDCVDGDSN
FDCLSGMGFSMLHSFEEVNCDAATWTMMPTT
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atggccccgaaagaggatatgctgccccctggctgggaggatctagacagacagatgggg
cagctcttcatgatgggcttcgatgggacgtcagtcaatcctcaaattcgctctcttatc
gagaattaccatctgggctcagttctgttgacagccaagaacttaaaatctgcagaagag
gcaacgcgactggtccttgagctacaaacaatcgcccgagatgctggccatcctgtgcct
ttacttatcgccttggatcaggaaaacggcggcgtgaatagcctgtacgatgaaatctac
atccgacagttccccagcgcaatgggaatcgcagcaactggttcaaagtcactggctcat
gatgtcgcttacgctacagcccaagagctcaaagctgtaggggtcaactggatccttggc
cctgtactagacgtgttgactaatgtacgaacccagccgctgggggttcgcactaccggc
gatgatccccaggaggtgtcgcaatatggcgttgagttcatgaaaggctacaaaaaagca
ggattggtgacatgtggcaaacactttccgtcctatggtaaccttgaattcctcgggtct
caaacagacgttcccatcatcaccgagtcgctggagcagctcagcttgacagcgctggtc
ccattccgcaatgccatagtccacggtttagattcgatgatggtgggaggtgtctcaatg
tcgtctgccggcgtgaatgtcatgcatgcttgtctgagtgagcaggttgttgatgacttg
ctgcggaaagatctgaaattcaatggtgtggtggtttctgagtgcttagagatggaggct
ctcactcacaatatcggtgtcggcggcggaacagtgatggcgaagaatgcgggctgtgat
atcatcctcttgtgcagatcctttccggtgcaacaggaggcgatcaatggtttgaagctc
ggggtggagaacggcatcattggtcgggctcgcatagagcaatctttgcgcagggttttg
aaaatgaaggcgaaatgcacctcttgggaccaagccttgaaccctccgggactgccatct
ctaatgcagatgcaaccatctcataccagcctctccaaaagggcatataacaactctatt
tcagttgtacgtgataagcagaatctgcttccgctgtccaacatcattgagcctaatgag
gaattgctacttttgactccgttagtcaagccattgcccgcatctgcagtctctcgttcg
gtgacggagcacatgaatgtctctatcgacccgattgcttcagatagaaccgcctctgtg
ctgagcggtgagagtgtcttcaaggaactgggtcgttctctctcacgtcaaagaagtggt
cgcgttcttcacacatcttacacggccaatggcgtccgaccaatccacgagaatttaata
gatcgggctagtgccgtcattgtcgtcactgccgatgcaaacaggaacctataccagcat
ggctttacgaaacatgtctctctaatctgtaggtctcagtttactccatcgggcgagccg
cgagagaagcctatgatcgtcatcgccgctagttccccatatgattttgccatggatacg
tccattggtacctatgtctgcacttacgatttcacagagaccgctttggaggcgttggtc
aaagttctctatggagaattgacaccaaaaggctcattgccgggttctatcagccgcagc
cagaagctccatcaagcgcggcagcactggcttgtagaaaactggaatgaagagagagat
gctcagtccttggatactttactggatgcagtcagagcggattgcgcgcagggtcagcgt
tctgagctgctaggtgtgacatccagcagcttcttattacgaagagaagaaattgacgag
gcgcattttgttgtacgaaacagcagtacgcaggctttgtacggattttgctcgacttat
ttctttaggtcgacgggcacaggcgttattggatctttgattgttgatcctgcaagacgg
aaactgtctattgggaactcactgcacaaccgcgcaatccgaacacttcttcagcgaaag
ggaatgaggaggtttcagctgggttctcgactcccaggcatatacctaggcattccgtct
tccaatccagtggagcgtaagaggttacgccagtggtttgccaacctgggctggaacact
gccctttcgcgaccggtttgcagtgtggtgctgcggaatcttccaacatggacgccgcct
gatggcctcgtacaggggttgaaaaatgctgacgtctcttacgaccttgttcatggatgg
gattatgcggagcctatccttgatcacatcaagacgaattctcgacaaggtcttattgat
atatacaagatcgctttgggaggagcaccaaactgtggcataatacgggccacgcggccg
agcgatggagcaattttgggtactgtggtgatatacaacggacggtcgccattggcagag
cacatgcctgtgctgaaagccacacaaccgtcgagcggaggcatatcgtctccagtgatc
tctccgtctgttggcgagtatgctacggtgatgcaggggctcatattactgggcatcaag
caaatccggagacaaggtgcagaggccgttgtcattgactgcgttgatggcgacagcaat
ttcgattgcctgtctggaatgggcttcagcatgctgcatagcttcgaggaagtgaactgc
gatgcagcaacctggaccatgatgccaacgacgtga

DBGET integrated database retrieval system