KEGG   Neosartorya fischeri: NFIA_099600Help
Entry
NFIA_099600       CDS       T01070                                 

Definition
pectinesterase family protein
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
nfi  Neosartorya fischeri
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NFIA_099600
   00500 Starch and sucrose metabolism
    NFIA_099600
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     NFIA_099600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 324 aa AA seqDB search
MHLPSLVLGLLGLGLTASASPIEERSNRSKAPDGCLTVGSSGKYSTIGAALDALGDSKSD
ACIFIGAGTYKEQITIDYKGKLTMYGETTDTSSYKKNQVTITHTISSPQAGTLDKSATVN
VRSDGFKMYNINVINGYGKGSQAVALVANADKLGFYGCSFVGYQDTLYAKAGRQYYSNCY
IEGATDYIFGNASAWFGECDIMSVGPGYITAMSRTTADQTTWYAIDNCNIYGKPGVDLTA
KVYLGRPWRVLARVIYQNSQLSNIINPKGWTTMAEGATPLYYEYNNKGAGADTSKREYES
SISGAVSMNTVLGSGWNSWIDTTY
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcatcttccctctctcgtcctcggccttcttggccttggcctcacggcttctgcaagc
ccaatcgaagaacggtctaatcgcagtaaagctccagacggatgcctcactgtcggctcg
tcgggcaagtactctaccatcggcgctgcgttggacgctctcggcgactccaagtccgac
gcctgcatcttcatcggtgccggcacgtacaaggagcagatcaccatcgactacaaggga
aaactcaccatgtacggcgagacaaccgacacgagttcttacaagaagaaccaggttact
atcacccatactatttcctctcctcaggcgggcacgcttgacaagagcgccacggtcaac
gtcaggtcggacgggttcaagatgtataacatcaatgttatcaatggctatggcaagggc
tcgcaggctgttgcgctcgtcgccaatgccgacaaacttggcttctacggatgcagtttc
gtcggctaccaagacactctctacgccaaggccggtcgtcaatactactctaactgctac
atcgagggagccacggactacatcttcggtaacgcatcggcctggttcggcgaatgcgac
atcatgtccgtcggccccggctacatcaccgccatgtcgcgcacgacagcggaccagacc
acctggtacgcgatcgacaactgcaacatctacgggaagcccggagtcgatcttaccgcc
aaggtctacctcggtcgcccatggcgtgtgcttgcccgtgtcatctaccagaattcccag
ttgtcgaacatcatcaaccccaagggctggacgaccatggcggagggcgcgacaccgctc
tactatgagtacaataacaagggtgctggagcggatacctcgaagagagagtatgagtct
tccatctctggtgctgttagcatgaacacggtccttggcagcggctggaacagctggatt
gataccacgtattaa

DBGET integrated database retrieval system