KEGG   Neosartorya fischeri: NFIA_099910Help
Entry
NFIA_099910       CDS       T01070                                 

Definition
beta-1,6-glucanase, putative
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
nfi  Neosartorya fischeri
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    NFIA_099910
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    NFIA_099910
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     NFIA_099910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 488 aa AA seqDB search
MRISVGALLGLTALSHATPEKRAVSASAYCSNSAGNYKLSSIAAPVQGTGNPGSESTWQL
TVDDTSSGHRQTIVGFGAAVTDATVTSFNTLSASVLQDLLNKLMTSAGANFALMRHTIGA
SDLSGDPAYTYDDNGGKADPSLSGFNLGDRGTAMAKMLATMKSLQPNLKILGSPWSAPGW
MKLNGVIDGNTNNNNLNDGYLTSGGTGSTGYASQFAQYFVKYIQAYKNLGAHVDAITIQN
EPLFSSAGYPTMYVYDYESAQLIQNYIGPALANAGLDTEIWAYDHNTDVPSYPQTVLNRA
GQYVKSVAWHCYAPNVDWTVLSQFHNTNPGVKQYMTECWTSASGAWHQAADFTIGPLQNW
ASGVAAWTLGTNAQNGPHLSTGGCATCQGLVTINNGGYTLNTAYYMMAQFSKFMPPGAIV
LNGSGSYTYSGSGGIQSVASLNPDGTRTVVIENTFSNDVYVTVTMKSGQKWSGNVPSQSV
TTWVLPSA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatatccgtcggtgctctgcttggcttgacagccctaagccatgccacaccagag
aaacgagccgtatctgcttctgcatactgttccaactcggccggcaactacaagctgtcc
tccatagcagccccagtccaaggaacaggaaatcccggctctgaatcaacttggcaattg
accgttgacgacacctcgtccggtcacagacagacgatcgttgggttcggtgctgccgtc
accgatgccacggtcacctcgttcaacactttgtcggcctccgtgttgcaggacctgctc
aataaattgatgacatcggccggggcgaactttgctttgatgcgacataccattggagct
tccgatctgtccggtgacccagcctacacatacgatgacaatggtggtaaagcggatccg
tcactgtcgggattcaacctgggggaccgaggaacggccatggccaagatgctggcaaca
atgaagtctctgcagcccaacctcaagatcctcggctctccctggagcgcgccaggatgg
atgaagctaaacggtgtcatcgatggcaatacgaacaacaacaacctgaacgatggatac
ctgaccagtggtggaactggtagtacggggtatgccagtcaattcgcgcagtactttgtc
aagtatatccaagcgtataagaatctcggtgcccacgtcgacgcaattaccatccagaac
gagccgctgtttagctcagctggttatcccaccatgtatgtctatgactatgagtcagcg
cagctgatccagaactacatcggcccagctcttgccaacgccggactcgataccgaaatc
tgggcttatgaccacaacacagatgtcccgtcctaccctcagactgtccttaaccgggcc
ggtcagtacgtcaagtcggtcgcttggcactgctacgctcccaacgtcgactggacagtg
ctaagccagttccacaacacaaaccctggagtgaagcaatatatgaccgagtgctggact
tcagcatctggcgcatggcatcaagcggctgacttcaccattggtcccctgcagaactgg
gcctcgggagttgcagcatggactctgggaaccaacgctcagaatggtccgcatctgtcc
actggcggctgcgcgacatgtcaaggcttggtgaccattaacaacggaggatacacgctc
aacaccgcatactacatgatggcgcaattcagcaagttcatgccacctggtgcgattgtg
ctcaatggcagtggcagctacacatactctggcagtggcggtatccagtccgtggcttcg
ttgaatcccgatggaacccgcactgtggttattgaaaacacttttagcaatgatgtctat
gtgactgtcactatgaagagcgggcagaagtggagtgggaacgttcctagccaatctgtg
actacctgggttcttccatctgcttga

DBGET integrated database retrieval system