KEGG   Aspergillus fischeri: NFIA_099910Help
Entry
NFIA_099910       CDS       T01070                                 

Definition
(RefSeq) beta-1,6-glucanase, putative
  KO
K22276  glucan endo-1,6-beta-glucosidase [EC:3.2.1.75]
Organism
nfi  Aspergillus fischeri
Brite
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.75  glucan endo-1,6-beta-glucosidase
     NFIA_099910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C
Motif
Other DBs
NCBI-GeneID: 4588832
NCBI-ProteinID: XP_001262252
UniProt: A1DBW5
AA seq 488 aa AA seqDB search
MRISVGALLGLTALSHATPEKRAVSASAYCSNSAGNYKLSSIAAPVQGTGNPGSESTWQL
TVDDTSSGHRQTIVGFGAAVTDATVTSFNTLSASVLQDLLNKLMTSAGANFALMRHTIGA
SDLSGDPAYTYDDNGGKADPSLSGFNLGDRGTAMAKMLATMKSLQPNLKILGSPWSAPGW
MKLNGVIDGNTNNNNLNDGYLTSGGTGSTGYASQFAQYFVKYIQAYKNLGAHVDAITIQN
EPLFSSAGYPTMYVYDYESAQLIQNYIGPALANAGLDTEIWAYDHNTDVPSYPQTVLNRA
GQYVKSVAWHCYAPNVDWTVLSQFHNTNPGVKQYMTECWTSASGAWHQAADFTIGPLQNW
ASGVAAWTLGTNAQNGPHLSTGGCATCQGLVTINNGGYTLNTAYYMMAQFSKFMPPGAIV
LNGSGSYTYSGSGGIQSVASLNPDGTRTVVIENTFSNDVYVTVTMKSGQKWSGNVPSQSV
TTWVLPSA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatatccgtcggtgctctgcttggcttgacagccctaagccatgccacaccagag
aaacgagccgtatctgcttctgcatactgttccaactcggccggcaactacaagctgtcc
tccatagcagccccagtccaaggaacaggaaatcccggctctgaatcaacttggcaattg
accgttgacgacacctcgtccggtcacagacagacgatcgttgggttcggtgctgccgtc
accgatgccacggtcacctcgttcaacactttgtcggcctccgtgttgcaggacctgctc
aataaattgatgacatcggccggggcgaactttgctttgatgcgacataccattggagct
tccgatctgtccggtgacccagcctacacatacgatgacaatggtggtaaagcggatccg
tcactgtcgggattcaacctgggggaccgaggaacggccatggccaagatgctggcaaca
atgaagtctctgcagcccaacctcaagatcctcggctctccctggagcgcgccaggatgg
atgaagctaaacggtgtcatcgatggcaatacgaacaacaacaacctgaacgatggatac
ctgaccagtggtggaactggtagtacggggtatgccagtcaattcgcgcagtactttgtc
aagtatatccaagcgtataagaatctcggtgcccacgtcgacgcaattaccatccagaac
gagccgctgtttagctcagctggttatcccaccatgtatgtctatgactatgagtcagcg
cagctgatccagaactacatcggcccagctcttgccaacgccggactcgataccgaaatc
tgggcttatgaccacaacacagatgtcccgtcctaccctcagactgtccttaaccgggcc
ggtcagtacgtcaagtcggtcgcttggcactgctacgctcccaacgtcgactggacagtg
ctaagccagttccacaacacaaaccctggagtgaagcaatatatgaccgagtgctggact
tcagcatctggcgcatggcatcaagcggctgacttcaccattggtcccctgcagaactgg
gcctcgggagttgcagcatggactctgggaaccaacgctcagaatggtccgcatctgtcc
actggcggctgcgcgacatgtcaaggcttggtgaccattaacaacggaggatacacgctc
aacaccgcatactacatgatggcgcaattcagcaagttcatgccacctggtgcgattgtg
ctcaatggcagtggcagctacacatactctggcagtggcggtatccagtccgtggcttcg
ttgaatcccgatggaacccgcactgtggttattgaaaacacttttagcaatgatgtctat
gtgactgtcactatgaagagcgggcagaagtggagtgggaacgttcctagccaatctgtg
actacctgggttcttccatctgcttga

DBGET integrated database retrieval system