KEGG   Neosartorya fischeri: NFIA_101730Help
Entry
NFIA_101730       CDS       T01070                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
nfi  Neosartorya fischeri
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NFIA_101730
Enzymes [BR:nfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     NFIA_101730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 350 aa AA seqDB search
MSSNTTHICVVGSLNIDFAVSTSRCPGPGETLTANSLSVTAGGKGANQAVACGRASLTSS
DVSKVTVSMIGAVGADDVYYATLIRPTLEDSGVDTKYIEEKTDSRTGSATIIVEDSAHGE
NRILVVPGANHAGMDDASKILATIQSYPQAPALVVLQGEIPRHTTLDLMRHFNHPGNPTH
ILFNPAPVFADGVPVDALSSTSVLVMNETEAVQMQASISPDSAIGTQTTDELKPEDLARQ
FHALANVKTVLITLGAKGVFFSTCTGRKGFVDGVRVQKVVDTTAAGDTFVGYFAAAFAEF
VATSAPLEEFDNAIEQAVRRANYAAALCVQRPGAMQSIPTALEVDILDSR
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccaacacgacccacatctgcgtcgtcggttcgctgaatatcgactttgcggta
tcaacatcccggtgtcccgggccaggggagaccttgacagcaaattccctctccgtgaca
gccggcggaaagggtgcaaaccaggccgtcgcatgcggtcgagcgtcgctcacctccagt
gacgtctcaaaagtcactgtgagcatgattggcgctgtgggcgccgacgacgtttactac
gcaacactgatccgaccgacgctagaggattctggcgtagatacaaagtatattgaagag
aaaacagacagccgcactggatctgcgacaatcatcgtcgaggattcagcgcacggcgaa
aacaggatcctggtggtgccgggggccaatcatgcggggatggacgatgcttccaagatc
ctcgccacgatccaatcctaccctcaggccccggctttggttgttctacaaggcgagatc
cccagacacacgactctggacttgatgaggcatttcaaccacccagggaatccgacacat
atcctgttcaatcccgccccggtcttcgcagatggcgtcccggttgacgcgctctccagc
acctctgttctggtcatgaacgagaccgaagcggtacaaatgcaggcatccatctctcca
gattcagcaatcggcacgcagacgacagacgaattgaagccggaagacctggcgaggcag
ttccatgctctcgccaacgtcaagactgtcctcattactcttggggcgaagggcgtgttc
ttctcgacttgcaccggcagaaagggcttcgtcgatggagtccgcgtacagaaagtggtt
gacacgacggctgctggtgacacctttgttgggtatttcgctgcggcatttgccgaattt
gtcgcgacatcggcaccgctggaagaatttgataacgcgattgagcaggccgtccgacgg
gcaaattatgctgcggcgttatgtgtgcagcggccaggtgcgatgcagagcattcccacg
gccttggaagtcgatattttggacagtcggtag

DBGET integrated database retrieval system