KEGG   Aspergillus fischeri: NFIA_102670Help
Entry
NFIA_102670       CDS       T01070                                 

Definition
(RefSeq) MAP kinase MpkA
Organism
nfi  Aspergillus fischeri
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kdo APH
Motif
Other DBs
NCBI-GeneID: 4594068
NCBI-ProteinID: XP_001266679
UniProt: A1CVY0
AA seq 422 aa AA seqDB search
MSDLQGRKVFKVFNQDFIVDERYNVTKELGQGAYGIVCAATNVHTGEGVAIKKVTNVFSK
KILAKRALREIKLLQHFRGHRNITCLYDMDIPRPDNFNETYLYEELMECDLAAIIRSGQP
LTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSIDPEE
NAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQ
ILHYLGTPNEETLSRIGSPRAQEYVRNLPFMPKIPFQRLFPNANPDALDLLDRMLAFDPA
SRISVEEALEHPYLHIWHDASDEPTCPTTFDFHFEVVDDVQEMRKMIYDEVVRFRNLVRQ
QSQAQAAAAAQQQQIAQQTNVPIPDHQQGGWKQEEPKPQEVHAAGGHANDLESSLQRGMD
VQ
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatctacagggtcggaaggtcttcaaggtcttcaaccaagactttatcgtggat
gaacggtacaatgtgaccaaggagctgggccagggtgcatacggtatcgtttgtgctgcc
acgaatgttcatactggcgagggcgtcgccatcaagaaggttaccaatgtcttcagcaag
aaaattctagccaagcgggcattgagagagattaagcttcttcagcacttccgcggccac
cgcaatatcacctgtctgtacgatatggacattccacgaccagacaatttcaacgaaacc
tatctgtacgaagagttgatggaatgcgatctggccgctatcatccgctcgggacagccc
ctgaccgacgcacactttcaatctttcatctaccagattttgtgtggactcaaatatatc
cattccgccaatgtcttgcaccgagatctgaagcctggtaacttgctggtcaacgcggac
tgcgagctcaagatctgcgatttcggtctggcccgtggtttttcgatcgaccccgaggag
aacgctggctacatgactgaatatgtcgcgacccggtggtaccgtgctcctgagattatg
ctgagcttccagagctacaccaaagctatcgacgtgtggtctgtaggatgcatcctggcc
gagctgctcggcggccgtcctttcttcaaaggccgggactacgtcgaccagctcaaccag
atcctgcactacctgggtacccccaatgaggagaccctgagccgcattggatctcctcgt
gcgcaggaatatgtccgcaacctgccgttcatgcccaagatccccttccagcgtttgttc
cccaacgccaaccccgacgcactcgatctgctcgaccgcatgctggcctttgacccggcg
tcgcgtatttccgtcgaggaagcgctggagcacccgtacctgcacatctggcacgacgcc
tccgacgagcccacctgcccgacgacattcgacttccactttgaggtcgtcgacgacgtg
caggagatgcgcaagatgatctacgacgaagtggtgcgcttccgcaacctcgtccggcag
cagtcccaggcgcaggccgccgctgccgcgcagcagcagcagattgctcaacagaccaac
gttcccatccctgaccaccagcagggaggctggaagcaggaggaacccaagcctcaggag
gtgcacgccgcgggcggccacgcgaacgatctggaatcgtcattgcagcgggggatggat
gttcaatag

DBGET integrated database retrieval system