KEGG   Neosartorya fischeri: NFIA_102670Help
Entry
NFIA_102670       CDS       T01070                                 

Definition
MAP kinase MpkA
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
nfi  Neosartorya fischeri
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    NFIA_102670
Enzymes [BR:nfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     NFIA_102670
Protein kinases [BR:nfi01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   NFIA_102670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 422 aa AA seqDB search
MSDLQGRKVFKVFNQDFIVDERYNVTKELGQGAYGIVCAATNVHTGEGVAIKKVTNVFSK
KILAKRALREIKLLQHFRGHRNITCLYDMDIPRPDNFNETYLYEELMECDLAAIIRSGQP
LTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSIDPEE
NAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQ
ILHYLGTPNEETLSRIGSPRAQEYVRNLPFMPKIPFQRLFPNANPDALDLLDRMLAFDPA
SRISVEEALEHPYLHIWHDASDEPTCPTTFDFHFEVVDDVQEMRKMIYDEVVRFRNLVRQ
QSQAQAAAAAQQQQIAQQTNVPIPDHQQGGWKQEEPKPQEVHAAGGHANDLESSLQRGMD
VQ
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatctacagggtcggaaggtcttcaaggtcttcaaccaagactttatcgtggat
gaacggtacaatgtgaccaaggagctgggccagggtgcatacggtatcgtttgtgctgcc
acgaatgttcatactggcgagggcgtcgccatcaagaaggttaccaatgtcttcagcaag
aaaattctagccaagcgggcattgagagagattaagcttcttcagcacttccgcggccac
cgcaatatcacctgtctgtacgatatggacattccacgaccagacaatttcaacgaaacc
tatctgtacgaagagttgatggaatgcgatctggccgctatcatccgctcgggacagccc
ctgaccgacgcacactttcaatctttcatctaccagattttgtgtggactcaaatatatc
cattccgccaatgtcttgcaccgagatctgaagcctggtaacttgctggtcaacgcggac
tgcgagctcaagatctgcgatttcggtctggcccgtggtttttcgatcgaccccgaggag
aacgctggctacatgactgaatatgtcgcgacccggtggtaccgtgctcctgagattatg
ctgagcttccagagctacaccaaagctatcgacgtgtggtctgtaggatgcatcctggcc
gagctgctcggcggccgtcctttcttcaaaggccgggactacgtcgaccagctcaaccag
atcctgcactacctgggtacccccaatgaggagaccctgagccgcattggatctcctcgt
gcgcaggaatatgtccgcaacctgccgttcatgcccaagatccccttccagcgtttgttc
cccaacgccaaccccgacgcactcgatctgctcgaccgcatgctggcctttgacccggcg
tcgcgtatttccgtcgaggaagcgctggagcacccgtacctgcacatctggcacgacgcc
tccgacgagcccacctgcccgacgacattcgacttccactttgaggtcgtcgacgacgtg
caggagatgcgcaagatgatctacgacgaagtggtgcgcttccgcaacctcgtccggcag
cagtcccaggcgcaggccgccgctgccgcgcagcagcagcagattgctcaacagaccaac
gttcccatccctgaccaccagcagggaggctggaagcaggaggaacccaagcctcaggag
gtgcacgccgcgggcggccacgcgaacgatctggaatcgtcattgcagcgggggatggat
gttcaatag

DBGET integrated database retrieval system