KEGG   Aspergillus fischeri: NFIA_103660Help
Entry
NFIA_103660       CDS       T01070                                 

Definition
(RefSeq) histone acetyltransferase (Gcn5), putative
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
nfi  Aspergillus fischeri
Brite
Enzymes [BR:nfi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     NFIA_103660
Transcription machinery [BR:nfi03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     NFIA_103660
Chromosome [BR:nfi03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    NFIA_103660
   HAT complexes
    PCAF complex
     NFIA_103660
    STAGA complex
     NFIA_103660
    TFTC complex
     NFIA_103660
    SAGA complex
     NFIA_103660
    SLIK complex
     NFIA_103660
    ADA-HAT complex
     NFIA_103660
    HAT-A2 complex
     NFIA_103660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 408 aa AA seqDB search
MPALTSESSKRKASEDAASPDSQKQIKKARTDSPEREPKTEDEPLGKPPLRIVPFPEKPA
VLEERRGEIEFRVVNNDGSRDSFVVLTGLKCIFQKQLPKMPKDYIARLVYDRSHLSIAIV
KHPLEVVGGITYRPFNSRKFAEIVFCAISSDQQVKGYGAHLMSHLKDYVKATSPIMHFLT
YADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTIMQCTMLPKIRYLEAGRMLLKQK
EAVQAKIRAFSRSHIIHPPPREWKNGACKIDPLSIPAIKESGWSPDMDELARQPRHGPNY
NQLLHLLNDMQNHSAAWPFTQPVNRDEVPDYYEVIKEPMDLSTMEEKHEKDMYPTPQDFI
KDAMLIFDNCRKYNNENTPYAKSANKLEKFMWQQIRNIPEWSHLADGH
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgccggcacttacatccgagagttccaagcggaaagcttcggaagatgcggcttctccg
gattctcagaaacagattaaaaaggcgcgcactgactctcctgaaagagagccaaagacc
gaagatgaacctcttggaaagccaccgctgaggatcgttcccttcccagaaaagcccgct
gtcttagaagaacgacgaggtgaaatcgagtttcgagtggtcaataatgatggctcgcgg
gatagtttcgtcgttcttaccgggttgaagtgcatctttcagaagcagcttccaaagatg
cccaaggattatatcgcacgccttgtctacgatcgttcgcatttgtctattgccattgtg
aagcacccattagaggttgtaggaggcatcacctaccggccgttcaatagccgcaaattc
gcggaaatcgtcttctgtgccatatcttcggaccagcaagtcaagggttacggtgcgcat
ttgatgtcacacttgaaggactatgtgaaagcgacctcgcccatcatgcatttcctgact
tatgcggacaactatgcgattggttatttcaagaagcagggattcaccaaggaaatcacg
ctcgacaagtctatatggatgggttatatcaaggattacgagggaggaaccatcatgcaa
tgtaccatgctccccaagatccgatacttggaagcaggtcgcatgcttctgaagcagaag
gaagcggtgcaagccaaaatcagggctttcagccgttcgcatattatccatcctccgcca
agggaatggaagaacggagcttgcaagatcgatcctctgagtatcccagccattaaggaa
tccggatggtcaccagatatggacgaattggcgcggcaaccgcgccatgggccgaactac
aatcagctcctgcacttgctcaacgacatgcagaaccacagtgctgcgtggccgttcact
caacctgtcaaccgcgatgaagttcctgattattacgaagtcatcaaagagccaatggac
ttatcgacgatggaagagaagcacgagaaggacatgtaccccaccccgcaagatttcatc
aaagatgccatgttgatctttgacaattgccggaaatacaacaatgagaacacaccatat
gcgaagagcgcgaataaattggaaaagtttatgtggcagcagattcgcaacatcccggag
tggtcgcatctggccgatgggcactga

DBGET integrated database retrieval system