KEGG   Neosartorya fischeri: NFIA_103660Help
Entry
NFIA_103660       CDS       T01070                                 

Definition
histone acetyltransferase (Gcn5), putative
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
nfi  Neosartorya fischeri
Brite
Enzymes [BR:nfi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     NFIA_103660
Transcription machinery [BR:nfi03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     NFIA_103660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 408 aa AA seqDB search
MPALTSESSKRKASEDAASPDSQKQIKKARTDSPEREPKTEDEPLGKPPLRIVPFPEKPA
VLEERRGEIEFRVVNNDGSRDSFVVLTGLKCIFQKQLPKMPKDYIARLVYDRSHLSIAIV
KHPLEVVGGITYRPFNSRKFAEIVFCAISSDQQVKGYGAHLMSHLKDYVKATSPIMHFLT
YADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTIMQCTMLPKIRYLEAGRMLLKQK
EAVQAKIRAFSRSHIIHPPPREWKNGACKIDPLSIPAIKESGWSPDMDELARQPRHGPNY
NQLLHLLNDMQNHSAAWPFTQPVNRDEVPDYYEVIKEPMDLSTMEEKHEKDMYPTPQDFI
KDAMLIFDNCRKYNNENTPYAKSANKLEKFMWQQIRNIPEWSHLADGH
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgccggcacttacatccgagagttccaagcggaaagcttcggaagatgcggcttctccg
gattctcagaaacagattaaaaaggcgcgcactgactctcctgaaagagagccaaagacc
gaagatgaacctcttggaaagccaccgctgaggatcgttcccttcccagaaaagcccgct
gtcttagaagaacgacgaggtgaaatcgagtttcgagtggtcaataatgatggctcgcgg
gatagtttcgtcgttcttaccgggttgaagtgcatctttcagaagcagcttccaaagatg
cccaaggattatatcgcacgccttgtctacgatcgttcgcatttgtctattgccattgtg
aagcacccattagaggttgtaggaggcatcacctaccggccgttcaatagccgcaaattc
gcggaaatcgtcttctgtgccatatcttcggaccagcaagtcaagggttacggtgcgcat
ttgatgtcacacttgaaggactatgtgaaagcgacctcgcccatcatgcatttcctgact
tatgcggacaactatgcgattggttatttcaagaagcagggattcaccaaggaaatcacg
ctcgacaagtctatatggatgggttatatcaaggattacgagggaggaaccatcatgcaa
tgtaccatgctccccaagatccgatacttggaagcaggtcgcatgcttctgaagcagaag
gaagcggtgcaagccaaaatcagggctttcagccgttcgcatattatccatcctccgcca
agggaatggaagaacggagcttgcaagatcgatcctctgagtatcccagccattaaggaa
tccggatggtcaccagatatggacgaattggcgcggcaaccgcgccatgggccgaactac
aatcagctcctgcacttgctcaacgacatgcagaaccacagtgctgcgtggccgttcact
caacctgtcaaccgcgatgaagttcctgattattacgaagtcatcaaagagccaatggac
ttatcgacgatggaagagaagcacgagaaggacatgtaccccaccccgcaagatttcatc
aaagatgccatgttgatctttgacaattgccggaaatacaacaatgagaacacaccatat
gcgaagagcgcgaataaattggaaaagtttatgtggcagcagattcgcaacatcccggag
tggtcgcatctggccgatgggcactga

DBGET integrated database retrieval system