KEGG   Neosartorya fischeri: NFIA_104300Help
Entry
NFIA_104300       CDS       T01070                                 

Definition
Formamidopyrimidine-DNA glycosylase, putative
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
nfi  Neosartorya fischeri
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    NFIA_104300
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     NFIA_104300
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     NFIA_104300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 367 aa AA seqDB search
MPELAEVSRIVHFIDQHLVGKTLTKVSAQNDDIVYGKVGTSASEFQKAMEGKKVVSAGQQ
GKYFWLIMNEPPHAVMHFGMAGWLKIRDADTYYYRVEKPEDKEWPPKYWKFLLETDGDPK
TEAAFVDFRRLSRIRLVDCPAEEIRKHSPLKDNGPDPVADKDIVTEEWLADKLKSRKVPI
KALLLDQANISGIGNWMGDEILYHAKIHPEQYSNTLNDEQIKQLHSSIHYVCTTSVDVLA
DSEKFPEHWLFKHRWGKGKKNKPSVLPNGEKIVFLTVGGRTSAVVPSVQRKTGPVAKDIG
DEDANSPKTETKRKRVTAVKKEEDVNDDEKEPKSKKYGSRSRKSEDAVEIKEEPKQEGRR
RSTRLRK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattagctgaagtctcgcgcatcgttcactttatcgatcaacatcttgttggg
aagactctcacgaaggtttctgctcagaacgatgatattgtctacgggaaagttgggacc
agcgcctctgaatttcaaaaggccatggaagggaaaaaggttgtcagcgcaggtcaacaa
ggaaagtatttttggctcatcatgaacgaacctcctcatgcagtgatgcatttcggaatg
gcaggctggctcaagatccgagacgccgatacatactactaccgcgtcgagaaacccgaa
gataaagaatggccaccgaaatattggaagttcctgctggaaacagacggggacccgaaa
accgaggcagctttcgttgacttccgcagattaagtcgtattcgacttgtggattgtcct
gcagaagagatccgcaaacatagcccactgaaagataatggtccggacccggtggctgat
aaagacatcgtcacggaagagtggctggcagacaagctcaagagcagaaaggttcccatc
aaggcccttctcctggatcaggctaatatcagtgggattggtaattggatgggtgacgag
atcttatatcatgccaagatacacccggagcaatatagcaatactctcaacgatgagcag
atcaaacagcttcactcctccatccattatgtttgtaccacgtcggtagatgtgctcgct
gattccgagaaatttcccgagcattggctgttcaagcatcgatgggggaagggaaagaag
aacaagccatcggtcctgccaaatggcgaaaagattgtttttctgactgtcggaggtaga
acgagcgccgttgtgccgagtgttcagagaaaaacgggccccgttgctaaagatattggc
gacgaggatgccaatagccctaagaccgagaccaaacgaaagcgggtaacggctgttaaa
aaggaggaggatgtgaatgacgatgagaaggagcccaaatcgaagaaatatggatcgcgg
tccaggaaatccgaggatgcagtggaaattaaggaggaaccgaagcaggagggaagacga
cgatccacgcgcctcagaaaatga

DBGET integrated database retrieval system