KEGG   Neosartorya fischeri: NFIA_104660Help
Entry
NFIA_104660       CDS       T01070                                 

Definition
glycerol kinase, putative
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
nfi  Neosartorya fischeri
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    NFIA_104660
Enzymes [BR:nfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     NFIA_104660
Exosome [BR:nfi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NFIA_104660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 564 aa AA seqDB search
MRNPFDLTELDNAVEEQQAHIDISAYQSHDGNRSLLQNENRRGDNLKDRFIGAIDQGTTS
SRFIIFDCTGVPVAKYQTEFRQIHEHSGWHEHDPLELVDSVYTCIEEAMKTFLALGHSKS
DIEAIGITSQRETTLCWDWETGEPLHNAIAWPDTRTKNLVRELKGQEGSDELPAICGLPL
STYPSSVSLVWLLRHSPKVKQAYDEGRLAFGTVDSWLLYNLNGGPEAGRHVTDVTNASRT
MFMNLETLQYDDKLLKFFGIDRKKIRLPKILPSSDPEGYGYVRFGPLDGVPITSCLGDQS
AALVGHCAFTPGTAKNTYGTGCFLLYNVGEKPVISKHGLLATVGFQLGKDRKPVYALEGS
VAVAGSGISFLMNNLGFFRDSRKVSDLAATVPDSGGCVFVTAFSGLFAPYWIDDAKGTIF
GITQHTQRGHIARATMEAACFQTKAILDAMARDSGHKLSELAVDGGMSNSDICMQTQADI
IQIPVERPAMHETTALGAAIAAGFAIDVWKEFSELKNMNRANRTSFTPRISPAQSARMYK
QWSKAVEMSRGWLDTSEIESEGQE
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaccctttcgatctgaccgagctcgataatgctgtcgaagagcaacaagcgcac
attgatatttccgcctatcaatcgcatgacggcaaccgctcgctacttcaaaatgaaaat
cgccgaggcgacaacctgaaagaccgcttcattggtgctatcgatcagggtactacgagt
tcacgatttattatcttcgattgcacaggtgttcctgtggccaagtatcagactgaattt
cgccagatccacgagcattcaggatggcacgaacatgatcccctcgaactcgtggattcc
gtttacacatgcattgaagaagcgatgaagactttcctggctttgggccacagcaaatca
gatattgaagccattgggattaccagccaacgagagacaacactttgctgggattgggaa
accggcgaaccgttacacaacgcgatcgcatggcctgataccagaaccaagaatctggtt
cgagagctcaaagggcaagaggggtcggatgaactaccggctatctgcggtctacctctc
tccacatacccttcttctgtctcactagtatggcttcttcgccatagccccaaagttaag
caggcttatgacgaaggacgacttgcttttggaactgttgactcgtggcttctgtacaac
ctcaacggcgggcccgaagctggtcgtcatgtcaccgacgttaccaacgcatccagaacg
atgttcatgaatctcgaaaccctgcaatatgatgataaactgctgaagttctttggtatc
gacaggaagaagatcaggctccccaagattctcccttcgtcagaccctgagggctatgga
tatgtccggtttggacctcttgacggagtgccgatcacgagttgcttgggcgatcagtcc
gcagctttagtcggtcactgcgcctttacaccgggcacagcgaaaaacacatatggcacc
ggttgcttcctgctctacaacgtcggtgagaaacccgtaatctcgaaacacggcttgctt
gccaccgttggcttccaactgggtaaagatcgaaagccggtgtatgcccttgaaggaagt
gttgctgtcgccggaagtggtatctccttcctcatgaacaacctcggattcttccgcgat
tcgcgcaaagtcagtgatcttgccgctactgttcccgacagcggaggttgcgtttttgtc
actgccttcagtggtctgtttgctccctactggattgatgatgccaagggaaccatcttt
ggtatcacacagcacacgcagcgcggacatattgctcgcgcgaccatggaagcagcctgc
ttccagacgaaggctattctcgatgccatggcaagggacagcggacacaaattgtcggaa
ttggccgtggacggcgggatgagtaattccgacatttgcatgcagacacaagccgacatc
atccaaatccccgtcgaacgccccgccatgcacgagaccaccgcgctgggcgccgccatc
gctgccgggttcgccatcgacgtctggaaggaattcagtgagctcaagaacatgaaccgc
gccaaccgcacctccttcacaccccgcatctcgcccgcgcagagcgcacggatgtacaag
cagtggtccaaggccgtcgagatgtcccgaggctggctggacacgagcgagatcgagtcc
gagggccaagagtaa

DBGET integrated database retrieval system