KEGG   Neosartorya fischeri: NFIA_104870Help
Entry
NFIA_104870       CDS       T01070                                 

Definition
histone acetyltransferase, putative
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
nfi  Neosartorya fischeri
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1046 aa AA seqDB search
MPATVLPAIDDPDTRPPADMVDSDQDAEGEEETDLYEMDQQLQNAVHRAYSGENADGDQD
ADYDEDEDAEGEPDTELNINGDNDDAELVGAAKMPDTAGSLDNDDAASAGVDAEDDPAFE
NPSDSDAPAASPSSSESEADEEWEAESNSREDAEVDTTVRGNCIFCGQDEDNDPSEEFEE
YLTCAVCGDHSHRQCAREQNALDETQDAGQWRCPTCVREKLQPSTEQNGTTPRQPRQKKM
RRELLPAHTGEKDSGFHSIFSTVDVSDELLTSSRSLRKRKASSTDVGEPTPGLRKLRRQS
SMRSARAESRDQGFGNTDGQSPVRTRSRRTRGEEKDTCRVVLRQFGRLVLAFRLNENKVS
KILNSRSRSQLRGRRTPKPPPAVQEPLSHFAPITPAPYISPFYSFNDRETDESKSKPYGG
ILSDADADTSRTLPTHADRERFEIARQKAEEEWQRKLLEAENSGEAVPHASQKLSGPPSR
IKYINFGGYEIETWYAAPYPEEYSRNRVLYICEFCLKYMNSDYVAWRHKLKCPAKHPPGD
EIYRDGSISIFEVDGRKNPVYCQNLCLLAKLFLGSKTLYYDVEPFLFYVMTEFDDLGCHF
VGYFSKEKRPSSANNVSCILTLPIHQRKGYGNLLIDFSYLLTRIEGKTGSPEKPLSDMGL
VSYRNYWRLILSYQLRNQKTPISIAELSERTGMTADDVVSGLEGLRALVRDPITKTYALR
LDCKYFEECIRNWEEKGYVQLNPDALVWTPYIMGRSNQSQFDRAPLHTVAQREDPEEEEG
EEVKKADGAVIPTASWTGHADSGGRSTVAAGPPSTQALSNTSGFHHLSTATASSSTSAPS
DPAAGIPPSRFEIYPPVQAPVFKRKPGRPFGSKSVFKAGGTPTSARASGRGTPRRTSMLA
SAATPTSNPGSVRRGRSAKLMDSPVPEPSVAKTNGLVNGEQHLQDGSEEAQDTEPQDAAP
SEPEAGTPNHTLNGTRSSGAVVAKANADVSLSDGPITPKGRGVENRGKLSRSASRKSIVE
MIPDHDAPQENNIADTDADGDAVMQT
NT seq 3141 nt NT seq  +upstreamnt  +downstreamnt
atgccggcgaccgtgctgccggccatcgacgatccagatactagaccgccggcggatatg
gtggacagtgatcaggatgcagaaggggaagaggaaaccgacctctatgagatggaccag
cagctacagaatgcagttcatcgggcatactctggggagaacgccgacggggatcaggat
gccgattacgacgaagacgaagatgcagagggtgaaccggatacggagctgaacatcaac
ggggataatgatgatgcagaactggttggtgccgccaagatgccggacacagccggctct
cttgacaacgatgatgccgcttctgcgggtgtcgatgcagaagatgatccggcgtttgag
aatccaagtgacagcgatgcacccgctgcctctccaagcagttcagaatcggaggccgat
gaggagtgggaggctgagagtaatagccgggaggatgcagaggtggataccactgtccgc
ggcaattgcatcttttgtggtcaagacgaggataatgatcctagcgaggaatttgaagag
tatttaacatgcgccgtctgtggtgaccattctcatcgacaatgtgcacgcgaacaaaat
gcactcgacgagacacaagatgccggtcaatggagatgccctacttgcgttcgggagaaa
ttgcagccaagtactgagcagaatggtacaaccccgcgacaacctcgtcaaaagaagatg
cgcagagaacttttaccggcacacactggagagaaagattctggtttccactcaattttc
agcaccgtggacgtcagcgatgagctcttgaccagctccagatcattgcgaaaaaggaaa
gcctcgtcgaccgacgtgggagaacccacacctggacttcgaaaattgcgacggcagtca
tcaatgcgatccgctcgagctgagtcccgagaccagggctttggaaatacagacggccag
tccccggtgcgtacccgttctcggcgaacgcgcggcgaggaaaaggatacctgccgcgtg
gttctgaggcaatttgggagactggttcttgcttttcgactcaacgaaaacaaagtgtcc
aagatcctcaattctcgaagccggtcacaactcagaggcagaagaacgcctaagccgcca
ccagcggtacaagaacctctgtcccattttgctcccattacacctgcaccctacatctcc
cccttctactcattcaacgaccgcgaaacagacgaatcaaaatcaaagccatacggcggt
attctgtcggatgcggatgcggacacctcaagaaccctgccaacacacgcagatcgtgaa
aggttcgagatcgcgcgacaaaaggccgaagaggaatggcaaaggaagcttttggaagct
gagaacagcggagaagccgtcccacacgcttcacagaagctttcgggtcctccgtcccga
attaaatacattaactttggaggatacgagattgagacctggtatgcagctccttatccc
gaagaatacagtcgcaaccgggtgctctacatatgcgagttttgcttgaaatacatgaat
tccgactatgtcgcctggcggcacaagctgaaatgccctgcaaaacatccgccgggagat
gaaatctaccgtgatggttccatctcaatattcgaggtcgacgggcgaaagaatccagtc
tactgccagaatctttgcttgctcgctaaattgttcttgggatccaaaacgctctactac
gatgtggagccgttcctgttctatgttatgactgaattcgacgatctgggctgccacttt
gtcggctatttcagcaaggagaaacggcccagttcggcaaacaacgtttcgtgcatcctc
acactgcccatccatcaaagaaaaggctatgggaatttgcttatcgacttctcatacctg
ctcactcgtattgaaggtaagactggctcgccagagaaacctctttccgacatgggcctg
gtatcctatcgcaactactggcgattgatactgtcgtatcaattacgaaaccaaaaaact
cctatcagcatcgcggaactctcagagcgaacaggcatgacggccgatgatgtggtctct
ggtttggaagggttacgcgcccttgtcagggatccaattaccaaaacctacgctttgcga
ctcgactgcaaatattttgaggagtgtattcggaactgggaggagaaaggctacgttcag
ctgaaccctgatgctttggtctggacaccatacatcatgggtcgcagcaatcagtcacaa
ttcgaccgggctccattgcacaccgttgcacagagagaagacccggaagaggaggaaggc
gaagaagtcaagaaggccgatggtgcagtcattccaacggccagctggacgggacacgcc
gattctgggggtcgttcgactgtggccgctgggcccccttcaacccaagcgctctctaac
accagcggtttccatcacctatcgactgctacagcgagttcgagtacctctgctccctcc
gaccctgccgctggcattcctccttctcggtttgagatttatcctcctgttcaagctcct
gtgttcaaacgaaaaccgggacgaccctttggcagtaagagcgtgttcaaggcgggcggg
accccgacaagtgcccgggcaagcggtcgcggtactccccgccgaacctcaatgttggcc
tcggcggcgacccctacttcgaatccaggtagtgttcggcggggtcggagcgccaagctg
atggactcacctgttccagagccgtccgtcgcgaagactaatggacttgtaaatggcgag
cagcatttgcaggatggatccgaagaagcgcaagacacagaacctcaggatgctgcaccg
tccgagccagaagcaggcacccctaatcacactctcaatggaactcgcagttcgggcgcc
gttgtagccaaggcaaatgccgatgtctctctttccgacggcccgattacaccaaaagga
aggggagttgagaacagagggaaactatcgcggtcagcaagccggaaatcgatcgtggag
atgatcccagatcatgacgcgcctcaggaaaacaacattgctgatacagacgccgatggc
gacgcagtcatgcaaacatga

DBGET integrated database retrieval system