KEGG   Neosartorya fischeri: NFIA_105910Help
Entry
NFIA_105910       CDS       T01070                                 

Definition
Glycosyl hydrolase, family 15, putative
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
nfi  Neosartorya fischeri
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NFIA_105910
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     NFIA_105910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 637 aa AA seqDB search
MNDETPRLAEMTRRQFLTIAIGVLTTVSALSDPAQIVIPATITPQTTDPLVSWLAQETSY
ALDGVFNNIGPNGAKATGASSGIVIASPSQSNPDYYYTWTRDAALTIKHLVGSFAADHDP
ALQRIIEDYIDSQAHLQTVSNPSGNLSSGGLGEPKLRVDGSAFRGSWGRPQSDGPALRAT
TLISYANLMIDNGYFSTVESSVWPIIQNDLSYLTEFWNSSTFDLWEEVRGSSFFTTAVQH
QALSQGAALTQSLGKTCSNCQSQAPQVLCFLQTYWTGSSILANLYSDRSGKDASSILGII
HTFDPNAGCDGETFQPCSERALASHKEVVDSFRSLYPINADIPQGQAVAVGRYPEDVYQG
GHPWYLCTLAAAEQLYDALYQWERLGSLAVTNISLAFFQDLYPSATVGTYAKDTSTFASI
TAAVRDYADGFLRVVQKYTPPNGALAEQFSRYDGSPVSAQDLTWSYTSFLTAVQARRRAL
NPSASHIQPLLPNATTATALPQVCTPSSARGPYRPVKRIKWPSPECLSPRRTVAVRFNVL
ATTVIGEDIFLVGSIPALGEWDARHQALKLEANEYSSITPLWYGTVMLDAGEEFEYKFIR
KRVGDGKVIWEEGQNRAFVVPNECGPSNATINAVWRW
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatgaaacaccgcgtctggccgagatgacgaggaggcagttcctgacgatcgcc
ataggcgtcttgaccactgtcagcgccctctcggaccccgctcagattgtgatcccagca
acaataacaccccagacgacggatcccttggtgtcatggttagcgcaggaaacttcatat
gccctcgatggtgtgttcaacaatatcggaccgaacggggccaaggcgaccggcgctagc
tctggcatcgtcatcgctagtcctagtcaaagcaatccggactactactatacctggact
cgagatgccgctctcaccatcaaacacctcgttggttcttttgccgccgatcacgatcct
gcactccaaaggatcatagaggattacatagattcccaggcgcacttgcagactgtctct
aacccttccggaaatctttcaagcggaggcttgggggaacccaagttgagggtggatgga
tcggcattccgtggctcctgggggcgtccacagagtgatgggcccgcgctgagagcaaca
acattgatatcctacgcaaacttgatgattgataatggttatttctctacggttgagtca
agcgtctggccaatcattcagaacgacctttcctatctgacggaattttggaactcttct
acttttgatctttgggaggaagttcgcggctcctcatttttcaccacggcagtccagcat
caagccctcagccaaggtgcagctcttacccagagccttggtaaaacctgttcgaactgc
cagtcacaggcaccgcaggttctctgtttcctgcagacttactggactggctcgtccata
ctggccaatctgtatagtgatcggtccgggaaagatgccagttcaatactaggcatcata
catacttttgaccccaatgcgggctgcgacggagagacgttccaaccgtgttctgagcgg
gcgcttgcaagccacaaagaagtcgtagactccttccgctcgctctacccgatcaatgca
gacatccctcagggccaagctgtagccgtgggtcggtacccagaggatgtctatcaaggt
ggacacccttggtatctgtgcactttggcagcagctgagcagctatacgatgcactttat
cagtgggagaggttggggtccctcgccgttacaaatataagcctcgcgttcttccaggac
ttgtacccatcagctacagttgggacctacgcgaaggacaccagcacatttgcctctata
actgcagcagttcgagattacgcagatggatttctccgcgtcgtgcaaaaatacacaccc
ccgaatggcgccctcgcagagcaattctcgcgctacgacggctcccccgtctcagcgcaa
gacctcacttggtcctacacatcctttcttactgcagttcaagcccgaagacgtgctctt
aatccttccgcatcacacatccaacctctcctcccaaacgcaaccaccgccaccgccctc
ccccaagtctgcaccccttcctccgcacgaggaccctaccgccccgttaaacgaatcaag
tggcccagcccagagtgcctctccccccggcgtaccgtcgcagttcggttcaatgtgctg
gcgaccaccgtcattggcgaggacatcttcctcgtcgggtccatccccgcgctgggcgaa
tgggatgcgcggcatcaggcattgaagttggaagcgaatgagtactcgagcatcacgccc
ttgtggtacgggaccgtgatgttggatgctggggaggagtttgaatacaaatttattcgg
aagagggtgggagatggtaaggttatctgggaagaagggcagaatcgagcatttgtggtg
ccgaatgagtgcggcccttccaatgccacgatcaatgccgtctggagatggtga

DBGET integrated database retrieval system