KEGG   Neosartorya fischeri: NFIA_106540Help
Entry
NFIA_106540       CDS       T01070                                 

Definition
glycosyl hydrolase family 10 protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
nfi  Neosartorya fischeri
Brite
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     NFIA_106540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 314 aa AA seqDB search
MVVLSKLISSILFASLVSAAVIERQATSINQAFTSHGKKYFGTASDQRLLQNSQNEAIVR
KDFGQLTPENSMKWDATEPSRGSFNFAGADFLVNYAKQNGMKVRGHTLVWHSQLPSWVSA
ITDKNTLTSVLKNHITTVMTRYKGQIYHWDVVNEIFNEDGSLRDSVFSRVLGEDFVRIAF
ETARSVDPSAKLYINDYNLDSASYGKTQGMVSHVKKWLAAGIPIDGIGSQTHLALTALAS
SGVSEVAITELDIAGASSQDYVNVVNACLGVPKCVGITVWGVSDKDSWRSSSSPLLFDSN
YQPKAAYNAIIAAL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtcctcagcaagctcatcagcagcattctctttgcctccctagtctcggcggcc
gtgatcgaacgccaggcaaccagcatcaaccaggcttttacatcccatggcaagaagtac
tttggcaccgccagtgaccaacgtctgctccagaactcgcagaatgaggccattgtgcgc
aaagactttggccagttgacgccggagaatagcatgaagtgggatgctactgagccatcg
cgaggaagtttcaacttcgctggtgctgatttcttggtcaactatgcaaaacagaatggc
atgaaggtccgcggacacaccttagtctggcactcccaactcccgtcctgggtgtcggct
atcaccgacaaaaacaccctgacctcggtgctgaagaaccacatcaccactgtcatgacc
cggtacaaaggccagatttaccattgggacgtcgtcaacgagatcttcaacgaggacggc
tccctccgcgacagcgttttctcccgcgtgctgggcgaggactttgtgcggattgccttc
gagacggcgcgctctgtggatccctctgcgaagctgtacatcaacgattacaatctcgac
tcggctagctatggcaaaacgcaggggatggtgagccatgtcaagaagtggttggctgcg
ggcattcctatcgatggaatcggctctcaaacccaccttgcattgactgcccttgcctcc
tccggcgtctccgaggtcgcgattactgagctggatatcgcgggtgctagctcccaggat
tacgtcaatgtcgtcaatgcatgcctgggtgtcccgaagtgtgtgggaatcaccgtctgg
ggggtgtcggacaaggactcgtggcgctccagctcgtctccactattgttcgacagcaac
taccagcccaaggcggcgtataatgccatcattgctgctctataa

DBGET integrated database retrieval system