KEGG   Neosartorya fischeri: NFIA_107060Help
Entry
NFIA_107060       CDS       T01070                                 

Definition
cytochrome c peroxidase Ccp1, putative
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
nfi  Neosartorya fischeri
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 366 aa AA seqDB search
MASAARSASRAFLRSTPATSSFRPAVRAARFALPSQGFRAAARRGYASEANSGKSSSNVF
LWAGLAVAGGAGAYFYLNGSDSVTSKTFVPGKEDYQKVYDAIARRLADETDYDDGSYGPV
LVRLAWHASGTYDKETGTGGSNGATMRFAPESDHGANAGLKIARDFLEPIKAQFPWITYS
DLWTLAGACAIQELGGPAIPWRPGRQDKDVAGCTPDGRLPDASKDQRHIRDIFYRMGFND
QEIVALIGAHALGRAHPDRSGYDGPWDFSPTVFTNEFFRLLLDEKWQNRKWNGPAQFTDK
TTKTLMMLPADLALVKDKEFKKHVERYARDNDAFFKDFSDVFVKLLELGVPFTSKAEDRY
VFKTSE
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcttcggctgctagatctgcttcgcgcgccttcttgcgctccactcctgctacctcc
tccttccgtcctgctgtccgcgccgctcgctttgctctcccatctcagggcttccgcgcc
gctgctcgtcgtggctatgcctccgaagccaactcgggcaagtcctcgtccaacgtcttc
ctctgggctggtctcgccgtggctggtggtgccggtgcatacttctacctgaacggcagc
gactccgttacctccaagacctttgttcctggtaaggaggactaccagaaggtgtacgac
gccattgctcgccgtctcgccgatgagaccgactatgacgatggcagctatggaccagtc
ctcgtccgtctggcatggcatgcaagtggtacctatgacaaggaaaccggcactggagga
agcaacggcgctaccatgagattcgcccccgagtccgaccacggtgccaacgctggcctc
aagattgctcgggacttcctcgagcccatcaaggcccagttcccttggattacctactcc
gatctctggactctggccggcgcctgcgccatccaggaactgggtggtcccgccattccc
tggcgccctggccgtcaggacaaggacgtagccggctgcacccctgatggacgtctcccc
gacgcttccaaggaccagaggcacatccgcgacatcttctaccgcatgggattcaacgac
caggagatcgttgctctgatcggtgcccacgctctgggccgtgctcaccccgaccgttct
ggctacgacggcccctgggacttcagccccaccgttttcaccaacgagttcttccggctg
cttcttgatgagaagtggcagaaccgcaagtggaacggccccgcccagttcactgacaag
accaccaagaccctgatgatgcttcccgccgatcttgccctagtcaaggacaaggagttc
aagaagcacgtcgagcgctatgccagggacaacgacgccttcttcaaggatttctcggac
gttttcgtcaagcttctcgagcttggtgtcccctttaccagcaaggctgaggaccgctac
gtcttcaagacctctgagtaa

DBGET integrated database retrieval system