KEGG   Neosartorya fischeri: NFIA_107290Help
Entry
NFIA_107290       CDS       T01070                                 

Definition
aldose 1-epimerase, putative
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
nfi  Neosartorya fischeri
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NFIA_107290
Enzymes [BR:nfi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     NFIA_107290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 318 aa AA seqDB search
MERSKKPSAIGVAASLPQPTITFRENKIEATLPTGESVTVHLYGATVTSWKLANGREQLF
MSEKAHLDGSKPIRGGIPVVFPVFGPPPPNHATSSLPQHGFARNSNWEFLGKSSSESLGK
KDCDDSVKLDFGLSHTMLSEEFRKAWPYEFGLLYSVTLSKEGLETSLQVQNKGNQNFDFQ
VLMHTYLSIDDISQIRVKNLESKTYIDKTQNATSHTENSPALEINKETDRVYKALDPKVP
IIVASAADDKPIFSVTREGLNDVVVWNPWIEKAKGMADFAPDDAYKKMICIEAGSVAGWQ
TLEAGESWEGSQSIRPRL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggagcggtctaagaagccctcagccattggtgtggccgcatcactaccccagcccacc
atcaccttccgcgaaaacaagatcgaggccaccttgcccaccggcgagtcagtcaccgtt
cacttgtatggagcaacggtcacctcgtggaagcttgcaaatggacgggaacagttgttc
atgagtgaaaaggctcatttggatggctccaagcctatccgtggtggcattcccgttgtg
ttccctgtctttggccctcctcctcccaaccacgctacctcctccctcccacagcatggc
tttgcgcgcaactccaattgggagttcctaggcaagtcatcgtccgaatcgctaggaaag
aaggattgtgatgattcagtcaagctcgactttggtctgtctcatactatgctgagcgag
gaattccggaaggcttggccgtatgagttcggccttttgtacagtgtcaccttgagcaag
gaaggtctggaaacatccctgcaagtgcagaacaagggcaaccagaatttcgacttccag
gttctgatgcacacctatctcagcattgatgatatctcgcaaatccgggttaagaacctc
gaatccaagacctacatcgataagacccaaaacgctacttcgcacactgagaactcgcct
gcgttggagatcaacaaggagacagatcgtgtgtacaaagcattggaccctaaggttccc
atcatcgtggcatctgccgctgacgacaagcctattttctctgttacacgcgagggattg
aacgatgtcgttgtctggaacccttggatcgaaaaggcgaagggcatggccgattttgcc
ccggatgatgcatacaagaagatgatttgcatcgaggctggttccgttgctggctggcag
accttggaggctggcgagtcctgggagggaagccagtcaatccgcccgagactgtag

DBGET integrated database retrieval system