KEGG   Neosartorya fischeri: NFIA_108480Help
Entry
NFIA_108480       CDS       T01070                                 

Definition
clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
nfi  Neosartorya fischeri
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    NFIA_108480
Exosome [BR:nfi04147]
 Exosomal proteins
  Proteins found in most exosomes
   NFIA_108480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1679 aa AA seqDB search
MAPLPIKFTELINLTNAEIAPQSIGFNSCTLESDHFVCVRQKLNEDDKPQVIIVNLKNNN
EVIKRPINADSAIMHWTKNIIALRAQGRTIQIFDLSAKQKLKSAVMNEDVVYWKWFSETS
LGLVTDASVYHWDVFDPTQNQPLKIFDRLPNLSGCQIINYRVNDDEKWMVVVGISQQQGR
VVGSMQLYSKDRGISQFIEGHAAAFASIRVEGSPLEHKLFTFAVRTQTGAKLQIAEIDHQ
EPNPRFQKKAVEVYFPQEAVNDFPVAMQVSRKYDIVYLVTKYGFIHLYDLETGTCIFMNR
ISSETIFTTAPDSESAGLVGVNRKGQVLSVSVDEGTIIQYLMENPAMSGLAVKLASKAGL
PGADHLYQQQFDNLLAQGNYSEAAKIAANSPRGFLRTPETINRFKNAPQTGQQMSVILQY
FGMLLDKGSLNKYESVELVRPVLQQNRKHLLEKWMRENKLEASEELGDIVRPYDMNMALA
IYLQANVPHKVIAGFAETGQFDKILAYSKQVGYQPDYTQLLQHIVRVNPEKGAEFAAQLA
NEESGALIDLDRVVDVFLSQNMIQQATSFLLDALKDNKPEHGHLQTRLLEMNLVNAPQVA
DAILGNEIFTHYDRPRISQLCENAGLIQRALENTDDPAVIKRNIVRTDKLNPEWLMNYFG
RLSVEQTLDCMDTMLEVNIRQNLQAVVQLATKFSDLLGPGQLISLFEKYRTAEGLYYYLG
SIVNLSEDPEVHFKYIEAATAMGQITEVERICRESNYYNPEKVKNFLKEAKLTEQLPLII
VCDRFNFIHDLVLYLYQNQQYKSIEVYVQRVNPSRTPAVVGGLLDVDCDEAIIKNLLSTV
EPSVIPIDELVSEVETRNRLKLLLPFLEATLATGNQQQAVYNALAKIYIDSNNNPEKFLK
ENDMYDTLTVGKYCEKRDPNLAYIAYRKGQNDLELINITNENAMYRAQARYLVERADPEI
WSFVLSENNLHRRSLVDQVIATAVPESTEPDKVSVAVKAFLEADLPGELIELLEKIILEP
SPFSDNGSLQNLLMLTAAKADKGRLMDYIHQLNEFSADEIAEMCISVGLYEEAFEIYKKV
NNYIAAVNVLVENIVSIDRAQEFAERVELPDVWSKVAKAQLDGLRVSDSIESYIRANDPS
NYLEVIETATHAGKDEELVKYLKMARKTLREPAIDTALAFCYARLDQLSELEDFLRTTNV
ADVETSGDKAYAEGYHQAAKIFYTSISNWAKLATTLVHLEDYQAAVECARKANSVKVWKE
VNQACVDKKEFRLAQICGLNLIVHAEELQDLVRQYERNGYFDELISVLEAGLGLERAHMG
MFTELGIALSKYHPDRVMEHLKLFWSRINIPKMIRACEEANLWPELVFLYCHYDEWDNAA
LAMMERAADAWEHHSFKDIIVKVANLEIYYRALNFYLQEQPLLLTDLLQVLTPRIDVNRV
VRIFQSSDNIPLIKPFLLNVQSQNKRAVNDAINDLLIEEEDYKTLRDSVDNYDNFDAVQL
AQRLEKHDLIFFRQIAANIYRNNKRWEKSISLSKQDKLYKDAIETAAISGKSDVVEELLR
YFVDIGSRECYVGMLYACYDLIRPDVILEMSWRHGLHDFTMPYMINFLCEQTRTIEMLKK
DNEERKAREASHKKEEDNTPILGGSRLMLTQGPAAPAPVPMAYGQANGITPQATGFRPF
NT seq 5040 nt NT seq  +upstreamnt  +downstreamnt
atggctcctcttcccatcaagttcacggagctcatcaatctgacaaatgccgaaattgct
ccacaatcgattggctttaactcatgtactttagaatcggatcatttcgtttgcgtgagg
caaaaactcaatgaagatgacaagcctcaagtcattatcgtcaacctcaagaataacaat
gaagtcatcaagcggccgatcaatgcggacagtgctattatgcactggaccaaaaacatc
atcgccctcagagctcagggtcgaacaattcagatcttcgacctttctgcaaagcagaag
ctcaagtctgcagtcatgaatgaagatgttgtctactggaagtggttcagtgaaacgagt
ctaggtttggtcaccgacgcatcggtctaccactgggacgtttttgatccaacccagaac
cagcctctcaagatttttgacagacttcctaacctgagcggttgccaaattatcaactac
cgtgtcaacgacgacgagaagtggatggtcgtggtcggtatcagccaacagcagggacgt
gttgtgggttcaatgcagctgtattccaaagatcgcgggatttctcaatttattgaagga
catgcagcagcttttgcttcaatcagagtcgaaggctctcctttggagcacaagctgttc
accttcgctgttcgtactcagaccggcgcgaaactgcagatcgccgagatcgatcaccag
gagccgaatccgcgcttccagaagaaggccgtggaagtgtacttcccgcaagaagcagtt
aatgatttcccggtcgctatgcaggtctccagaaagtacgacatcgtttacctcgttacc
aagtatggcttcattcatctttacgacctcgaaaccggaacctgcatcttcatgaaccgt
atctccagcgaaacaatcttcactacggcccccgactcagaatctgcaggcctggtcggt
gtcaaccgcaaaggccaagtcctgtcggtcagcgttgatgagggaactattatccagtac
ctgatggagaaccctgccatgtctggacttgcggtgaagctcgcgtcaaaggctggcctt
cctggagcggatcacctctaccagcagcagttcgacaacttgctggcgcaaggcaattat
tctgaagctgccaagatcgctgccaactctccccgaggcttccttcgtacgcccgagacc
attaaccgtttcaagaatgcgcctcaaactggccaacagatgtctgtaatcctacagtac
ttcggtatgctcttggacaagggatccctcaacaagtatgagagtgttgagcttgtgcgc
cctgtcctgcaacagaacaggaagcacctgctggagaaatggatgcgtgagaataagctg
gaagcctccgaggaactcggagatatcgtccgaccatacgacatgaacatggctttggcc
atctatctgcaagccaatgtacctcacaaggtcattgccgggtttgctgagactggtcaa
tttgacaagatcctcgcctattcgaagcaggttggataccagcctgattacactcaactt
ctgcagcacattgtccgcgtcaaccccgagaagggtgccgaattcgctgctcagcttgcc
aacgaggaaagtggcgcactcattgatcttgaccgcgtcgtggacgtcttcctgtcgcag
aacatgattcagcaggcaacctcgttcttgctcgatgccctcaaggacaacaagcccgag
cacggccacctacagacacggttgcttgagatgaacctcgtcaacgctccccaggttgca
gacgcaatccttggtaacgagattttcacccactatgaccgtcctagaatctctcagctc
tgcgagaatgccggcctcatccaacgtgctttggaaaatactgatgaccctgcggtgatc
aagcggaacattgttcgtacagacaagttgaaccctgaatggctcatgaactactttggg
cgcctttccgtggaacagacgcttgactgcatggacaccatgttggaggtgaacatccgc
cagaacttgcaggctgttgttcagcttgcaaccaagttctcggatctccttgggcccggt
caactcatcagccttttcgagaagtaccgtaccgctgagggtctctactactatcttgga
agcatcgtcaaccttagcgaggaccctgaagttcatttcaagtatatcgaggctgctact
gccatgggccagatcaccgaggtcgagcgcatctgccgcgagagcaactactacaacccg
gagaaggtcaagaatttcctgaaagaagccaagttgaccgagcagcttcccctcatcatc
gtttgcgaccgtttcaacttcatccacgatttggttctctacctataccagaatcaacaa
tataagtcaatcgaggtctatgtgcagcgtgttaacccttctcgcactccggccgtcgtt
ggaggcttgttggatgttgactgtgatgaagctatcatcaagaaccttctgtctaccgtt
gagccctctgttattcccattgatgagctcgtctccgaggttgaaacacgaaacagattg
aaactgctcttacctttccttgaagccactctggcgactggcaatcagcaacaggccgtt
tacaatgctcttgccaagatttacatcgacagcaacaacaaccccgagaagttcctcaag
gagaacgacatgtatgacacgttgaccgtcggtaaatactgcgagaagcgtgatccgaac
ctggcctacattgcatacaggaagggacaaaatgacctggagcttatcaacattaccaat
gagaatgccatgtaccgggcccaagctcgttacctcgttgagcgtgccgatcctgagatt
tggtcgttcgtcttgagcgagaataacttgcaccgccgttctcttgtcgatcaggtcatc
gcaacggcagtccctgaatcgactgaacctgacaaggtttccgttgccgtcaaggcgttc
ctcgaggcagatctccctggcgagcttattgagctcctggaaaagatcattctcgagccc
tcgcccttcagcgacaatggtagcttgcagaaccttctgatgttgacggcagctaaggcc
gacaagggacgtctgatggattacattcatcagctcaatgagttcagcgctgacgagatc
gccgagatgtgtatctccgtcgggctgtacgaggaagcgttcgagatctacaagaaggtc
aacaactacattgctgccgtcaatgttcttgttgagaacatcgtcagcattgaccgtgct
caagaatttgccgagcgcgttgagttgccggatgtgtggagcaaggttgcaaaggcacag
cttgacggtctccgcgtgtctgactcgatcgagtcgtacatccgcgccaatgatccctcg
aattacctcgaggtcatcgagactgccactcacgccggcaaagacgaggagcttgtcaaa
tatctcaagatggctcgcaagacactgcgggagccagccattgacaccgcccttgctttc
tgctatgctcgtcttgaccaactatcggagctcgaggacttcctacgtaccaccaacgtg
gccgatgtcgaaacgtctggtgacaaggcctatgctgaaggctaccaccaggcagccaag
atcttctatacgagcatctccaactgggccaagcttgctaccaccctggtgcacttggaa
gattatcaggctgcagtcgagtgtgcacgcaaggccaacagtgtcaaggtttggaaggaa
gtcaaccaggcctgtgtggacaagaaggagttccggctcgcccagatttgcggtctcaac
ctcattgtgcatgccgaggaactgcaggatcttgtgcgccaatacgagcgcaatggctac
ttcgacgagttgatcagtgttctcgaagctggtctgggactggagagggcacacatgggc
atgttcaccgagcttggcattgctctgtccaagtaccaccctgaccgggtcatggagcac
ctcaagctcttctggtctcgcatcaatatccccaagatgatccgcgcgtgcgaggaagca
aatctctggccagagctagtgttcttgtattgtcactacgacgagtgggacaacgccgct
ttggcaatgatggagcgtgccgcggatgcctgggagcaccattcattcaaggatatcatt
gttaaggttgccaatctggagatttactatcgtgctctgaacttctatctgcaggagcag
cctctacttcttacggatctactccaggtcttgacccctcggatcgacgtgaaccgtgtt
gtacgcattttccagagctccgacaacattcctcttatcaagccgttcctgttgaacgtc
cagtctcagaacaagagagccgtcaatgatgccatcaacgacctcttgatcgaggaggag
gattacaagactctacgtgactcggtggacaactatgacaactttgatgcggtgcagctg
gcgcagcgtctcgagaagcatgacctcatcttcttccggcagattgcggcgaacatctac
cgtaataacaagcgctgggagaagtcgatttcgctttccaagcaggacaagctatacaag
gatgccattgagaccgcggcgatttctggcaagtcggacgtggtcgaggagcttcttcgc
tactttgtcgacattggcagccgcgagtgctacgtcggcatgctgtatgcctgctacgat
ctcatccgccccgatgtcatcctggagatgtcctggcgtcacggtcttcatgatttcacc
atgccctacatgatcaacttcctctgcgagcagacacgtacgatcgagatgctgaagaag
gacaatgaggaacgcaaggcgcgggaagcgtcgcataagaaggaagaagacaacacacca
atcctgggaggctcacggctcatgctgacccaagggccggcggcgcctgcccctgtaccg
atggcatacggacaagctaatggcatcacgccgcaagccactggcttccgtcctttttag

DBGET integrated database retrieval system