KEGG   Neosartorya fischeri: NFIA_108870Help
Entry
NFIA_108870       CDS       T01070                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase, putative
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
nfi  Neosartorya fischeri
Brite
Enzymes [BR:nfi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     NFIA_108870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 384 aa AA seqDB search
MGSAISSFLDSLPPLRDFILPSPQAYTTLLNVFQYFPVFSLVQWAVSWHPAGKGSYQSSW
LNIPGKLGWFLMEIVGPANLLYILYKLPSALNITSLPLSNKLVASLYVIHYVNRAIISPF
FAAPSMSPMHASVVSMAVLFNWLNSTCLAGWLVGYHVPVLGYKTDGAVSGAPGGSSPYSA
ATHFLPCLGMVLFAAGMIGNIHSERTLFRLRRQAAEKRDAAKKSDEDVTQHGDEDHPTFI
QASSSSSSSDANANANANGKKNKYDKVYVIPPARGVFRSILYPHYAFEWLEWLGFALVGT
AVFPAAQALAYASPPLHIAPWLKPAAAFAEKLQVPLPLPAVVFVVNAVANMLPHARWGRK
WYVEKFGEKAVAGRGAAVPWCSWL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgggctccgcaatctcgtcgttcctggattctcttccccccttgagagacttcatcctc
cccagtccccaggcctacacaaccttgctcaacgtattccaatactttccagtgttctcg
ctcgtccagtgggctgtctcctggcatccagctggtaaaggctcctaccagagctcctgg
ctgaacatcccaggcaaactgggctggtttctcatggagatcgtgggaccggcgaacctg
ctctacatcctttacaaattgccgtcagcgctcaacattacctcgctcccactatctaat
aagctcgttgcgtccctatatgtaatccactatgtcaaccgcgccatcatctcgccattc
ttcgcggcccccagcatgtcccccatgcatgcgtccgtcgtctccatggcagtgctgttc
aactggctcaactcgacctgtctggccggttggctggtgggataccacgtcccggtgctg
gggtacaagaccgacggcgccgtctcgggcgctccgggagggtcgtcgccctactccgcc
gcaacgcacttcctgccctgcctggggatggtcctcttcgcagccggtatgataggcaac
atccactcggagcgcaccctcttccgtctccgccgccaagcagcagagaagcgcgacgcg
gctaagaagtccgacgaggatgtcacccaacatggagacgaggaccatccgaccttcatc
caggcatcgtcctcgtcctcgtccagcgacgcgaatgccaacgccaacgccaacggcaag
aagaataaatatgacaaggtctacgtcatcccacccgcccgcggcgtcttccgctccatc
ctctacccgcattacgccttcgaatggctcgagtggctcggcttcgctctcgtcggcacg
gccgtcttccccgccgctcaggcactcgcctatgcctcgccgcccttgcacatcgctccg
tggctgaagcccgctgcggcgttcgccgagaaactacaggttcccctgcctcttccggcg
gtcgtgtttgttgttaatgcggtggctaatatgctgcctcatgcgcgctgggggaggaag
tggtatgtagagaagtttggggagaaggcggtcgcgggtcgaggggctgctgttccatgg
tgttcgtggctgtga

DBGET integrated database retrieval system