KEGG   Aspergillus fischeri: NFIA_113720Help
Entry
NFIA_113720       CDS       T01070                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00010  Glycolysis / Gluconeogenesis
nfi00071  Fatty acid degradation
nfi00350  Tyrosine metabolism
nfi01100  Metabolic pathways
nfi01110  Biosynthesis of secondary metabolites
nfi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NFIA_113720
  Lipid metabolism
   00071 Fatty acid degradation
    NFIA_113720
  Amino acid metabolism
   00350 Tyrosine metabolism
    NFIA_113720
Enzymes [BR:nfi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NFIA_113720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C adh_short
Motif
Other DBs
NCBI-GeneID: 4589323
NCBI-ProteinID: XP_001262738
UniProt: A1D8Y0
AA seq 353 aa AA seqDB search
MTKDSVPSMQWAQVAEKVGGPLVLKQIPVPKPGPDEILVKIRYSGVCHTDLHAMKGDWPL
PVKMPLVGGHEGAGIVVAKGDLVTEFEIGDHAGIKWLNGSCLACEFCKQADEPLCQNASL
SGYTVDGTFQQYTIGKATHASKIPKNVPLDAVAPVLCAGITVYKGLKESGARPGQTVAIV
GAGGGLGSLAQQYARAMGLRVIAIDGGDEKRVMCEQLGAEAYVDFTKSSDLVADVKAATP
DGLGAHAVILLAVSEKPFQQATEYVRSRGTVVAIGLPANAFLRAPVLNTVVRMINIKGSY
VGNRQDGVEAIDFFARGLIKAPFKTAPLEDLPKIYELMEQGKIAGRYVLELPE
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagactccgtcccctccatgcaatgggcccaagtagccgaaaaagtcggcggc
cctctagtcctcaagcaaatccccgtcccgaagcccgggcccgatgagatcctcgtcaag
atccgctactcaggcgtctgccacaccgacctccacgccatgaaaggcgactggcccctc
ccagtcaagatgccactcgtcggcggacacgagggcgccggcatcgtggtagccaagggc
gacctcgtcactgaattcgagatcggcgaccacgccggcatcaagtggttgaacgggtct
tgtctcgcatgtgaattttgcaagcaggcggatgaaccgctttgccagaatgcctcgctg
tccgggtataccgtcgacggcaccttccagcagtacactattggcaaggcgacgcatgcg
tctaagattcccaaaaacgtgcccctggatgcggtggcgccggtgctgtgtgccggtatt
accgtgtacaaggggttgaaggagtccggggctcggcctgggcaaacggttgcgattgtt
ggtgcgggtggtgggttgggatccctggcgcagcagtatgcgcgcgccatggggttgcgg
gttattgctattgatggtggggatgagaagcgggtgatgtgcgagcagcttggtgctgag
gcatacgttgatttcaccaagtccagtgatctggtcgctgatgtcaaggcagccacgccg
gatgggctgggtgcgcatgctgtgattctcctggccgtctcggagaagcccttccagcag
gctaccgagtatgttcgctcgcgcggtactgtcgtcgccattggattgcctgcgaacgcc
ttcctgagggcaccggtcctcaacactgtcgtgcgcatgatcaacatcaagggtagctat
gttgggaatagacaggacggtgtcgaggctattgatttctttgctcggggactgatcaaa
gctcctttcaagactgctccgcttgaggatctgcctaagatctatgagctcatggaacaa
ggcaagattgctggtcgctacgtccttgagctgcctgaatga

DBGET integrated database retrieval system