KEGG   Neosartorya fischeri: NFIA_114180Help
Entry
NFIA_114180       CDS       T01070                                 

Definition
cap binding protein
Orthology
K03259  
translation initiation factor 4E
Organism
nfi  Neosartorya fischeri
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    NFIA_114180
Translation factors [BR:nfi03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    NFIA_114180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 249 aa AA seqDB search
MAEVAENGPVPVNDENTAPGAATEEKEQTEKTEQTNGDAVTVFHDPENFNVKHPLMHEWT
LWFTKPPSGKGDNWNDLLKEVVTFNSVEEFWGIYNNITPTSELGLKADYHLFKKGIRPEW
EDPQNKHGGKWSYSFKDKRSVPIDDLWLHAQLAAIGETLENDGDNEVMGVVVNVRKGFYR
VGLWTRTVGKSIPGDKNGRTPAQGKEILENIGRRFKEVLRLKEADVVEFSGHTDSAHSGS
TRAKAKYTV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagtcgcagagaacggtcctgtgccggtgaacgacgagaacaccgctcctggc
gccgctaccgaagaaaaggagcagaccgagaagaccgagcagacaaatggcgatgcggtc
acagtattccatgaccccgaaaatttcaacgtgaagcatccgctcatgcacgaatggact
ctctggttcacgaagccccccagtggcaagggcgacaactggaacgatctgttgaaggag
gtcgtgactttcaactcggttgaggaattttggggtatctacaacaatatcacaccgact
tctgaactgggtctcaaggcagactaccatctcttcaaaaagggcatcagaccagagtgg
gaagacccccagaacaagcacggtggcaagtggtcatactcgttcaaagacaagcgctcc
gtaccgattgatgatctttggcttcacgctcaactggcagctatcggcgagactcttgag
aacgatggcgacaacgaggttatgggtgtggtcgtgaacgtgcgtaagggattttaccgt
gttggtctgtggacacggacggtgggcaagagcattcccggcgacaagaacggccggaca
cccgctcaagggaaggagattctcgaaaacattggtcggcgcttcaaggaggtgctacgc
ctgaaggaagccgatgtcgttgagttctcggggcacacggacagcgcacacagcggtagc
actagagccaaggccaagtacaccgtttaa

DBGET integrated database retrieval system