KEGG   Neosartorya fischeri: NFIA_114560Help
Entry
NFIA_114560       CDS       T01070                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase Ugp1, putative
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nfi  Neosartorya fischeri
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:nfi00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:nfi00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:nfi00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:nfi00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 521 aa AA seqDB search
MAAKALPTHLRAPANEASGDGSFGKHHAKSQSHMAFENASTSVAASQMRNALNALAETVP
DPEEKKRFEAEMDNFFALFRRFLNDKAKGNVVNWDRINPPAPNQVVDYNDLGAEASVEFL
NKLAVVKLNGGLGTSMGCVGPKSVIEVREGMSFLDLSVRQIEHLNRTYNVNVPFVLMNSF
NTDQDTQSIIKKYQGHNVDIITFNQSRYPRIIKDSLLPAPKSFDAPLQDWYPPGHGDVFE
SLYNSGTLDKLLERGVEYIFLSNADNLGAVVDLRILQHMADTDAEYIMELTDKTKADVKG
GTIIDYEGKARLLEIAQVPKEHVNEFKSIKKFKYFNTNNIWMNLRAIKRVVEENELEMEI
IANEKSIPADKKGEADQAIYQLETAVGAAIRHFKNAHGVNVPRRRFLPVKTCSDLLLVKS
DLYRLEHGQLVMDPNRFGGVPVIKLGSDFKKVSDFQKRIPSIPRIVELDHLTITGAVNLG
RNVTLKGTVIIVATEGSTIDIPPGSVLENCVVQGSLRILEH
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaaagctttgcctactcacctcagagctcccgccaacgaggcctccggcgat
ggctcgttcggaaagcaccacgcaaaatcccagtctcacatggccttcgagaatgcctcc
accagtgtcgctgcttctcagatgcgtaacgctctgaatgccctcgccgagaccgttccc
gaccccgaagagaagaagcgcttcgaggccgagatggacaacttcttcgctctcttccgc
agattcctcaacgacaaggccaagggcaatgtcgtcaactgggaccgcatcaaccctcct
gcgcctaaccaggtcgtcgactacaatgacctgggcgccgaggcctcggtggaattcctg
aacaagctggccgtcgtaaagctcaacggtggtcttggtacctccatgggttgcgttggc
cccaagtccgtcattgaagtccgtgagggcatgtccttcttggatttgtccgttcgtcag
attgagcacctgaaccgcacctacaacgttaacgtgccctttgttctgatgaactcgttc
aacaccgaccaggacacccagtccatcatcaagaagtaccaaggccacaacgtcgacatc
atcaccttcaaccagtcccgctaccctcgtatcatcaaggactctctcctccccgccccc
aagagctttgacgctcctctgcaggactggtaccctcccggtcatggtgacgttttcgag
tcgctgtacaactcaggcactctggacaagctgctcgagcgtggtgtcgagtacatcttc
ctctccaatgccgacaacctcggtgccgttgtggatctccgcatcttgcagcacatggct
gacactgatgccgagtacatcatggagttgaccgacaagaccaaggccgacgtcaagggt
ggtaccatcattgactacgagggcaaggcccgtctgctcgaaatcgcccaggtgcccaag
gagcacgtcaacgagttcaagtccatcaagaagttcaagtacttcaacaccaacaacatc
tggatgaacctccgcgccatcaagcgtgttgttgaggagaacgagttggagatggaaatc
attgccaacgagaagtccatccccgccgacaagaagggcgaggccgaccaggccatctac
cagctggagactgccgtcggtgcggccatccgccacttcaagaacgctcacggtgtgaac
gttccccgtcgccgtttcctgcccgtcaagacttgctccgatctcttgctggtcaagtcg
gatctctaccgtctcgagcacggtcagctcgtcatggaccccaaccgtttcggcggtgtc
cccgtcatcaagcttggatcagacttcaagaaggtgtcggatttccagaagcgcatcccc
agcattcctcgcatcgtcgagctggaccacctcacaattaccggtgctgtcaacctcggc
cgcaatgtcaccctgaagggtaccgttatcatcgtcgccaccgagggcagcacgatcgac
attccccctggctcggtgctggagaactgtgtggtccagggaagcttgagaatcctggag
cactaa

DBGET integrated database retrieval system