KEGG   Nocardia farcinica NCTC11134: ERS450000_00635Help
Entry
ERS450000_00635   CDS       T04524                                 

Gene name
paaJ_1
Definition
(GenBank) Beta-ketoadipyl-CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
nfr  Nocardia farcinica NCTC11134
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Module
C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:nfr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ERS450000_00635 (paaJ_1)
   00630 Glyoxylate and dicarboxylate metabolism
    ERS450000_00635 (paaJ_1)
   00640 Propanoate metabolism
    ERS450000_00635 (paaJ_1)
   00650 Butanoate metabolism
    ERS450000_00635 (paaJ_1)
  Lipid metabolism
   00071 Fatty acid degradation
    ERS450000_00635 (paaJ_1)
   00072 Synthesis and degradation of ketone bodies
    ERS450000_00635 (paaJ_1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ERS450000_00635 (paaJ_1)
   00310 Lysine degradation
    ERS450000_00635 (paaJ_1)
   00380 Tryptophan metabolism
    ERS450000_00635 (paaJ_1)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ERS450000_00635 (paaJ_1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ERS450000_00635 (paaJ_1)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ERS450000_00635 (paaJ_1)
Enzymes [BR:nfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ERS450000_00635 (paaJ_1)
Exosome [BR:nfr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ERS450000_00635 (paaJ_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:591541..592761
Genome map
AA seq 406 aa AA seqDB search
MPEAVIVAAARSPIGRAGKGSLKEMRPDDLTVQMVRAALAQVPALDPAQVEDLLLGCGQP
AGESGFNMARTVAVLAGLDTVPGTTVNRYCSSSLQTTRMALHAIKAGEGEVFISAGVETV
SRFGKGSADGWPDTQNPVFADAVARTAERASGGAADWADPRAQGLLPDVYIAMGQTAENV
AQFTGITRAEQDAFGVRSQNLAEKAIADGFWATDITPVTLPDGTVVSADDGPRAGVTMEA
VSQLKPVFRPDGTVTAGNCCALNDGAAALVIMSDTKARDLGITPLARIVSTGVSALSPEI
MGLGPIEASKQALGRAGLTIDDIDLVEINEAFAVQVLGSARELGIPEDKLNVNGGAIAVG
HPFGMTGARITSTLINSLRFHDKQFGLETMCVGGGQGMAMVLERLS
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgccggaagctgtgatcgtcgccgctgcccgttccccgatcgggcgggcgggcaagggc
tcgctgaaggagatgcgtcccgacgacctgaccgtgcagatggtgcgggccgcgctggcc
caggtgcccgccctggacccggcccaggtcgaggaccttctgctcggctgcgggcagccc
gcgggcgaatcgggcttcaacatggcccgcacggtggcggtgctggccgggctggacacg
gttcccggcaccaccgtgaatcgctactgttcctccagcttgcagaccacccggatggcg
ctgcacgccatcaaggcgggcgagggtgaggtgttcatctccgcgggcgtggagacggtg
agccggttcggcaagggcagcgccgacgggtggcccgacacccagaatccggtcttcgcc
gacgccgtcgcccgcacggccgaacgagcgagcgggggcgccgccgactgggccgacccg
cgcgcgcagggtctcctgcccgacgtctacatcgcgatgggccagaccgcggagaatgtc
gcgcagttcaccggcatcactcgcgccgaacaggacgcgttcggtgtccgttcgcagaac
ctcgccgagaaggccatcgccgacggcttctgggccaccgacatcacccccgtcacgctg
ccggacggcaccgtggtcagtgccgacgacggcccgcgcgcgggcgtcaccatggaggcg
gtgagccagttgaagccggtgttccggcccgacggcaccgtcaccgcgggcaactgctgc
gcgctcaacgacggcgcggcggcgctggtcatcatgtccgacaccaaggccagggatctg
ggcatcaccccgctcgcgcgcatcgtcagcaccggcgtctccgcgctgtccccggagatc
atgggcctgggcccgatcgaggcgtccaagcaggcgctgggccgggccggtctcacgatc
gacgacatcgacctggtcgagatcaacgaggcgttcgccgtgcaggtgctcggctcggcc
cgcgaactcggtatcccggaagacaagctgaacgtcaacggcggcgcgatcgcggtgggc
cacccgttcggcatgaccggcgcccgcatcaccagcaccctgatcaactcgctgcgcttc
cacgacaagcaattcgggttggagaccatgtgtgtcggcggcggccagggcatggccatg
gtgctggagcggctgtcgtga

DBGET integrated database retrieval system