KEGG   Nocardia farcinica NCTC11134: ERS450000_03959Help
Entry
ERS450000_03959   CDS       T04524                                 

Gene name
fadA_3
Definition
(GenBank) Putative acyltransferase Rv0859
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
nfr  Nocardia farcinica NCTC11134
Pathway
nfr00071  Fatty acid degradation
nfr00072  Synthesis and degradation of ketone bodies
nfr00280  Valine, leucine and isoleucine degradation
nfr00310  Lysine degradation
nfr00362  Benzoate degradation
nfr00380  Tryptophan metabolism
nfr00620  Pyruvate metabolism
nfr00630  Glyoxylate and dicarboxylate metabolism
nfr00640  Propanoate metabolism
nfr00650  Butanoate metabolism
nfr00900  Terpenoid backbone biosynthesis
nfr01100  Metabolic pathways
nfr01110  Biosynthesis of secondary metabolites
nfr01120  Microbial metabolism in diverse environments
nfr01130  Biosynthesis of antibiotics
nfr01200  Carbon metabolism
nfr01212  Fatty acid metabolism
nfr02020  Two-component system
Module
nfr_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:nfr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ERS450000_03959 (fadA_3)
   00630 Glyoxylate and dicarboxylate metabolism
    ERS450000_03959 (fadA_3)
   00640 Propanoate metabolism
    ERS450000_03959 (fadA_3)
   00650 Butanoate metabolism
    ERS450000_03959 (fadA_3)
  Lipid metabolism
   00071 Fatty acid degradation
    ERS450000_03959 (fadA_3)
   00072 Synthesis and degradation of ketone bodies
    ERS450000_03959 (fadA_3)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ERS450000_03959 (fadA_3)
   00310 Lysine degradation
    ERS450000_03959 (fadA_3)
   00380 Tryptophan metabolism
    ERS450000_03959 (fadA_3)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ERS450000_03959 (fadA_3)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ERS450000_03959 (fadA_3)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ERS450000_03959 (fadA_3)
Enzymes [BR:nfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ERS450000_03959 (fadA_3)
Exosome [BR:nfr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ERS450000_03959 (fadA_3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CRY80627
UniProt: A0A0H5NYV5
Position
p2:complement(461432..462646)
Genome map
AA seq 404 aa AA seqDB search
MTTEAYIYEAIRTPRGRGKKNGSLHSVKPIDLTVGLIQELRSRFPNLDEDRISDVILGVV
APVGDQGADIARTAVTVAGLPDTVGGFQLNRFCASGLEAVNLAAQKVRSGFDDLVIAGGV
ESMSRVPMGSDGGAWALDPATNYDTYFVPQGVSADLIATIEGFSREDVDAYAVRSQELAA
KATTGGYFAKSIVPVKDQNGLVVLDRDEHMRPGTTLEDLAKLQPSFAMIGEMGGFDAVAL
QKYHFVEKINHVHHGGNSSGIVDGAALVLVGSEEAGKASGLTPRARVVATATSGADSTIM
LTGPTPAAKKVLAKAGLTLDDIDLVEINEAFASVVLKFQKDLNIPDEKLNVNGGAIAMGH
PLGATGAMITGTMVDELERRNGRYALITLCIGGGMGVATIIERV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaccacagaggcctacatttacgaggccatccgcactccgcgcggccgcggcaagaag
aacggttcgctgcactcggtcaagccgatcgatctgactgttggtctgatccaggagctg
cgcagccgcttccccaacctcgacgaggaccggatctcggacgtgatcctcggtgtggtc
gcgccggtgggtgaccagggcgccgacatcgcgcgcaccgccgtcaccgtcgccggcctg
cccgacaccgtgggcggtttccagctgaaccgcttctgcgcctcgggtctggaagcggtc
aacctcgccgcccagaaggtgcgctccggcttcgacgacctcgtcatcgccggtggtgtc
gagtccatgtcccgcgtgccgatgggctccgacggtggcgcctgggcgctggacccggcc
accaactacgacacctacttcgtgccgcagggtgtctccgccgacctgatcgccaccatc
gagggcttcagccgcgaggacgtcgacgcctacgcggtgcgctcgcaggagctggccgcc
aaggccaccaccggcggctacttcgccaagtcgatcgttccggtcaaggatcagaacggc
ctggtcgtgctggaccgcgacgagcacatgcggcccggcaccaccctcgaggacctggcc
aagctgcagccctccttcgccatgatcggtgagatgggcggcttcgacgcggtggcgctg
cagaagtaccacttcgtggagaagatcaaccacgtccaccacggcggcaacagctcgggc
atcgtcgacggcgccgcgctggtgctggtcggctcggaagaggcgggcaaggcctccggc
ctgaccccgcgcgcccgcgtcgtcgcgaccgccaccagtggcgccgactccaccatcatg
ctgaccggccccacgccggccgccaagaaggtgctcgccaaggcgggcctgacgctggac
gacatcgacctggtcgagatcaacgaggcgttcgcctccgtggtgctcaagttccagaag
gacctgaacatcccggacgagaagctgaacgtcaacggtggcgccatcgcgatgggccac
ccgctgggcgccaccggcgccatgatcaccggcaccatggtcgacgagctggagcgtcgc
aacggccgctacgcgctgatcaccctgtgcatcggcggcggcatgggcgtggccaccatc
atcgagcgggtctga

DBGET integrated database retrieval system