KEGG   Candidatus Nitrososphaera gargensis: Ngar_c02930Help
Entry
Ngar_c02930       CDS       T02305                                 

Gene name
fbp
Definition
(GenBank) bifunctional fructose-1,6-bisphosphatase
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
nga  Candidatus Nitrososphaera gargensis
Pathway
nga00010  Glycolysis / Gluconeogenesis
nga00030  Pentose phosphate pathway
nga00051  Fructose and mannose metabolism
nga00680  Methane metabolism
nga01100  Metabolic pathways
nga01110  Biosynthesis of secondary metabolites
nga01120  Microbial metabolism in diverse environments
nga01130  Biosynthesis of antibiotics
nga01200  Carbon metabolism
nga01230  Biosynthesis of amino acids
Module
nga_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ngar_c02930 (fbp)
   00030 Pentose phosphate pathway
    Ngar_c02930 (fbp)
   00051 Fructose and mannose metabolism
    Ngar_c02930 (fbp)
  Energy metabolism
   00680 Methane metabolism
    Ngar_c02930 (fbp)
Enzymes [BR:nga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Ngar_c02930 (fbp)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Ngar_c02930 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: AFU57241
UniProt: K0I7L4
Position
225741..226898
Genome map
AA seq 385 aa AA seqDB search
MQITVSAIKADIGGIGGHTRPSDELLETVRNFVAKNSKGLLIDHYIGYTGDDIHIIMTHT
RGVDDEKIHKLAWDAFTEGTKTAKEQGLYGAGQDLLKDSFSGNVKGMGPGVAEIEMEERP
SEVFCIFAADKTEPGAFNFPLWRMFVDARSNSGLLINERLAEGVVFRIMDVMTGKVAELK
MWQDKAELEAALMYPGRYVVHSVVSADGTDQIVSASTDRLHNIAGTYVGKDDPIAIVRTQ
KNFPATEEAGSAFNDPHYVAGNTRGSHHMPLMPVKLNSAASLNYSIPIVSCLLFSMHNGK
LTGPHDGFGTADWDLQRMWAAERAMIMRNQGFIHPATLVPDELEYNKGYEARMSKLESKF
RNLEDIMNGKTKKAATKAKEAGSKR
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcacagttagtgcaatcaaggccgatattggggggatcgggggccacacccgc
ccaagcgatgaactcctcgagaccgtcagaaattttgttgccaaaaactcaaagggcctg
cttatcgatcattacatcgggtacaccggcgacgatatacacatcataatgacccatacg
cgtggcgtggatgacgaaaagatccacaagctggcgtgggatgcctttacagagggaacc
aagaccgcaaaggaacaggggctttacggcgccggccaggacctgctgaaggactcgttc
tccggcaatgtcaagggcatggggccgggcgtggctgaaattgaaatggaggagcgccca
agcgaagtgttttgcatctttgcagccgacaagacagagccgggcgcgttcaactttccg
ctctggcgcatgttcgtggacgcgcgtagcaactctggcctcctgatcaacgagcgcctt
gcagaaggcgtcgttttcaggataatggacgtcatgactggcaaggtcgcagaactaaag
atgtggcaggacaaggccgagcttgaagccgcgctgatgtaccccggccgctacgtcgtt
cattctgttgtttcggctgacggcacggaccagatagtgtcggcgtccaccgaccgcttg
cacaacatcgccggcacgtacgtcggcaaggacgaccccattgcaatagtcaggacgcaa
aagaactttccggccacggaggaggcaggaagcgctttcaacgaccctcactatgtcgcc
ggcaacacgagaggcagccaccacatgccactcatgccagtcaagctcaactctgccgca
agcctgaactactctatccctatcgtctcatgtctgctcttcagcatgcataatggcaag
ctcaccgggccgcacgacggctttggcactgccgactgggacctccagaggatgtgggca
gctgagcgggctatgataatgcgcaaccaaggctttatccatccagccacgcttgtgcct
gacgagcttgaatacaacaagggctatgaggcaaggatgtcaaagctggaaagcaagttc
aggaacctcgaagacatcatgaacggcaagacaaagaaggcggcaacaaaagcaaaagaa
gctggcagcaagcgttga

DBGET integrated database retrieval system