KEGG   Candidatus Nitrososphaera gargensis: Ngar_c02940Help
Entry
Ngar_c02940       CDS       T02305                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nga  Candidatus Nitrososphaera gargensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ngar_c02940 (tpiA)
   01230 Biosynthesis of amino acids
    Ngar_c02940 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ngar_c02940 (tpiA)
   00051 Fructose and mannose metabolism
    Ngar_c02940 (tpiA)
   00562 Inositol phosphate metabolism
    Ngar_c02940 (tpiA)
Enzymes [BR:nga01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ngar_c02940 (tpiA)
Exosome [BR:nga04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ngar_c02940 (tpiA)
  Exosomal proteins of bladder cancer cells
   Ngar_c02940 (tpiA)
  Exosomal proteins of melanoma cells
   Ngar_c02940 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
226895..227554
Genome map
AA seq 219 aa AA seqDB search
MKRPLIINFKNYAEVSGDKAIKLAKAAQAVAKKLKVEIVVAPPQPALAVIAKSVRMPVIS
QHVDDEKVGSSTGYFLPEIAKSYGAVGSLINHSEHRMEMKNIANLVERLRSLRMTSIVCA
REPWEVMEISLFQPDFIAIEPPELIGTGRAVSKENPAIITKSIEAAASRSKVICGAGISG
KDDVAKAMELGSHGILVASGIIKASSWPAKIAELAAGMK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcggccactgatcatcaacttcaaaaattacgcagaagtatcaggagacaaggct
atcaagctggccaaggccgcgcaggcagtcgcaaaaaagctaaaggtggaaatagtagtt
gcgcccccacagccagcgcttgcagtcattgcaaaaagcgtcaggatgcctgtcatcagc
cagcacgttgacgacgaaaaggtgggttcaagcaccggctactttttgcccgaaatagcc
aagtcgtatggcgcggttggctcgctgataaaccacagcgagcacaggatggaaatgaag
aatatagccaacttggtagagcgcctccgcagcctgcgcatgacctcgatagtgtgcgcc
cgcgagccgtgggaggtcatggagatatcactctttcagccagactttatcgcgatcgag
ccgccagagctgatcgggactggccgggcggtgtcaaaggaaaacccagcgataataaca
aagtcgatagaggcagcagcgtcgcgctcaaaggttatatgcggcgccggcatcagcggc
aaggatgacgtggccaaggcgatggagcttggctcgcacggcatactcgtggcaagcggc
ataatcaaggctagctcgtggcccgccaagatagccgagcttgcagccggcatgaaataa

DBGET integrated database retrieval system