KEGG   Candidatus Nitrososphaera gargensis: Ngar_c02940Help
Entry
Ngar_c02940       CDS       T02305                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nga  Candidatus Nitrososphaera gargensis
Pathway
nga00010  Glycolysis / Gluconeogenesis
nga00051  Fructose and mannose metabolism
nga00562  Inositol phosphate metabolism
nga01100  Metabolic pathways
nga01110  Biosynthesis of secondary metabolites
nga01120  Microbial metabolism in diverse environments
nga01130  Biosynthesis of antibiotics
nga01200  Carbon metabolism
nga01230  Biosynthesis of amino acids
Module
nga_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ngar_c02940 (tpiA)
   00051 Fructose and mannose metabolism
    Ngar_c02940 (tpiA)
   00562 Inositol phosphate metabolism
    Ngar_c02940 (tpiA)
Enzymes [BR:nga01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ngar_c02940 (tpiA)
Exosome [BR:nga04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ngar_c02940 (tpiA)
  Exosomal proteins of bladder cancer cells
   Ngar_c02940 (tpiA)
  Exosomal proteins of melanoma cells
   Ngar_c02940 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG IGPS His_biosynth
Motif
Other DBs
NCBI-ProteinID: AFU57242
UniProt: K0IHG7
Position
226895..227554
Genome map
AA seq 219 aa AA seqDB search
MKRPLIINFKNYAEVSGDKAIKLAKAAQAVAKKLKVEIVVAPPQPALAVIAKSVRMPVIS
QHVDDEKVGSSTGYFLPEIAKSYGAVGSLINHSEHRMEMKNIANLVERLRSLRMTSIVCA
REPWEVMEISLFQPDFIAIEPPELIGTGRAVSKENPAIITKSIEAAASRSKVICGAGISG
KDDVAKAMELGSHGILVASGIIKASSWPAKIAELAAGMK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcggccactgatcatcaacttcaaaaattacgcagaagtatcaggagacaaggct
atcaagctggccaaggccgcgcaggcagtcgcaaaaaagctaaaggtggaaatagtagtt
gcgcccccacagccagcgcttgcagtcattgcaaaaagcgtcaggatgcctgtcatcagc
cagcacgttgacgacgaaaaggtgggttcaagcaccggctactttttgcccgaaatagcc
aagtcgtatggcgcggttggctcgctgataaaccacagcgagcacaggatggaaatgaag
aatatagccaacttggtagagcgcctccgcagcctgcgcatgacctcgatagtgtgcgcc
cgcgagccgtgggaggtcatggagatatcactctttcagccagactttatcgcgatcgag
ccgccagagctgatcgggactggccgggcggtgtcaaaggaaaacccagcgataataaca
aagtcgatagaggcagcagcgtcgcgctcaaaggttatatgcggcgccggcatcagcggc
aaggatgacgtggccaaggcgatggagcttggctcgcacggcatactcgtggcaagcggc
ataatcaaggctagctcgtggcccgccaagatagccgagcttgcagccggcatgaaataa

DBGET integrated database retrieval system