KEGG   Candidatus Nitrososphaera gargensis: Ngar_c03740Help
Entry
Ngar_c03740       CDS       T02305                                 

Definition
histone acetyltransferase (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
nga  Candidatus Nitrososphaera gargensis
Brite
Enzymes [BR:nga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Ngar_c03740
Transfer RNA biogenesis [BR:nga03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Ngar_c03740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
277912..279495
Genome map
AA seq 527 aa AA seqDB search
MTDNNNSSYQQACRSIAEQIESRKLLSVRQALKVVREVASAYHLDTMPKNEHIIHHIHDN
RYRRLLMVKPAKTASGVAVVAVMPKPYECPHGRCTYCPGGIEFNTPLSYTGTEPATKAAQ
KFSYDPYQQVCGKMEQLQSRGHDTGKTEIVIVGGTFPFMPADYQREFAKSCYDALNGRRS
SSLQEAISINETADNRCVGFTVETKPDYCKEPHIDLMLELGVTRVEIGVQSLRNSVYKLV
NRGHTLDDVVDAFRIARDAGYKIVAHMMPGLPGSSPEKDVEDFRRLFEDDAFKPDMLKIY
PTLVLEHTGLFRMHKAGKYRAYSDDDFVNVIVEAKKVVPEWVRIMRVQREIESKDIVAGP
KSGNLRQIVLQRLRQQGYRCRCIRCRETGLQRRYPDEDEVTLRRTDYSASGGREVFLSYE
SKDGDTILGFLRLRRVAKPHRNELGGAAIVRELHVYGQAVSVGSKEIDGSYQHRGYGTKL
LREAERIAKDEFGVTKIAVISAIGTRQYYKKKLGYCQDGPYVSKVLL
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
gtgactgacaacaacaatagcagctatcagcaggcctgcagatcgatcgccgagcagatc
gagagcaggaaactactgtcagtcaggcaggccctcaaggttgtcagggaagtggcatcg
gcctaccatctggacacgatgccaaagaacgagcacatcattcatcatattcatgataat
cgctaccggcgtctattgatggtcaagccggccaagacagcgtctggcgtagcagtagtt
gcggtgatgcccaagccatacgagtgcccacatggcaggtgcacctactgcccaggtggc
atcgaattcaacacgccgctcagctataccggcacagagccggcgacaaaggccgcgcaa
aagttcagttacgacccataccagcaggtatgcggcaagatggagcagctgcaatcaaga
ggccacgacactggcaagaccgagatcgtgatcgtggggggcacctttccatttatgcct
gcagactaccagagggagtttgcaaaatcgtgctatgacgctctcaacggcaggagatca
tctagcctgcaagaagcgatatccatcaacgagactgcagacaacaggtgcgtcgggttc
acagttgaaacaaagcccgattattgcaaagagccgcatattgacctgatgctcgagctt
ggggtaacaagggtagagatcggtgtccagtcgcttcgcaatagcgtctacaaactggtg
aacagagggcatacgcttgacgatgtggttgacgcatttaggattgcacgggacgccggc
tacaagatagtcgcgcacatgatgcctggcctgccgggtagctcacctgaaaaagatgtc
gaggacttcaggcggctatttgaagatgatgctttcaagccggacatgctaaagatctac
ccgacgcttgtgctggaacacaccggcctcttcaggatgcacaaggccggcaagtatcga
gcttactctgatgatgattttgtcaatgtcatagttgaagcaaagaaggtggtgccagag
tgggtacgtataatgcgtgtgcagcgtgaaatagagtcaaaggacattgttgctggaccc
aagagcggcaacctccggcagatcgtactgcaaaggctgaggcagcagggctataggtgc
aggtgcatcaggtgcagggaaaccggcctgcagaggaggtaccctgatgaagacgaagtt
acgctgagaaggactgattactctgcttcaggtggacgagaagtattcctgtcatatgaa
agcaaggacggcgacaccatacttggctttctgcggctgcgcagggtggcaaagcctcac
aggaacgagcttggcggagccgccatagtgcgcgaactccatgtgtacgggcaggcggtg
agcgtcggaagcaaagagatcgatggcagctaccagcacagagggtatggcacaaaattg
ctaagggaagccgagcgcattgcaaaagacgaatttggagtcaccaagatcgcagtaatt
agcgccatcggcacaagacaatactacaagaagaagctgggttactgtcaggacggcccg
tacgtttcaaaggtgttgttatag

DBGET integrated database retrieval system