KEGG   Candidatus Nitrososphaera gargensis: Ngar_c04600Help
Entry
Ngar_c04600       CDS       T02305                                 

Definition
alpha-D-phosphohexomutase (EC:5.4.2.-)
Organism
nga  Candidatus Nitrososphaera gargensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(343299..344597)
Genome map
AA seq 432 aa AA seqDB search
MKISISGVRGVYGQDLNLHEVSIFASQFASVIKSGKCVVARDTRPSGMIIAQTVVAGLMA
GGVDVYNLGVAPTPAAFREARRFGAGVIITASHNPLEWNGLKFIIEGRGLFERELAKMLK
SVGGCEGKFGSEFRISSRYVDEVADVAKGGAKVKVGIDPGGGAACGYGERLFKKLGHQYH
SINGVAGVSSRGPDPTADELADLRALVTANKLDHGFALDLDADRLVVVNNMGEKLNPDAT
LLLCVARSLEMGMKKFVTSIDTSVAIEKYVRDHKGKISYSKVGEANVVSKMLEVDAEAGG
EGSSAGFIMPKFNMCRDGLLAAATISTLDKKTIDSCLKFASQFVQIRSKITAESAFHKKV
IEKLPDIFKRDASSIMTEDGVKAIIDDDSWVLVRPSNTEHAIRVSVESRAGKAQALFKDA
SEKVQAAYDQVR
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatatcgatctcgggcgtcagaggggtttacgggcaggacctcaacctgcatgaa
gtgagcatattcgcaagccaattcgccagtgtaataaaatctggcaagtgtgtggtcgca
agagatacccgcccgtctggcatgataatcgcccagactgttgtggcaggcttgatggca
ggaggcgtcgatgtttacaatctgggcgttgctcccacaccggcggcgtttcgggaggcg
cgcaggttcggcgcaggtgtgataataacggcatctcacaacccgctagaatggaacgga
ttaaagttcataatcgagggcaggggactttttgagcgcgagcttgccaagatgttaaag
tcggtaggcggctgcgaaggcaagtttgggagcgagtttcggatctcttcgcgttatgtg
gacgaagtggcagacgttgcaaaaggcggcgcgaaggttaaggtcggaatcgatcccggc
ggcggagccgcatgtggctatggcgaaagactgttcaaaaagctgggccaccagtaccac
agcattaacggcgtcgcaggcgtgtcgtcaaggggccccgatcctaccgcggacgagctt
gcggatctgcgcgcacttgtaactgcaaacaagctagaccacggctttgcgctcgatctt
gatgccgacaggcttgtagtggtcaacaatatgggagaaaaattaaacccggacgcgacc
ctgcttctgtgcgtggctaggtcacttgagatgggcatgaaaaagtttgtgaccagcata
gacaccagcgtcgcaatagaaaagtacgtccgtgaccataaaggcaaaatatcatactcc
aaggtgggcgaggcgaacgttgtcagcaagatgcttgaggtagacgcggaggccgggggc
gagggaagtagcgcaggttttatcatgcccaagttcaacatgtgccgcgacgggctcttg
gcagctgccacgatttcgacccttgacaaaaagacgatagattcatgcttgaaatttgct
tcgcagtttgtgcagataaggtcaaagataacggccgagtctgcgtttcacaaaaaagtg
attgaaaagctgcccgatattttcaagcgcgacgcgtcttctataatgaccgaagacggc
gtcaaggcgataatagacgatgactcgtgggtgctggtcaggccatcaaacaccgagcac
gcgatcagagtctctgtcgagtccagagccggcaaggcgcaggcactcttcaaggatgca
agcgaaaaggtccaggcagcatatgaccaagttagatga

DBGET integrated database retrieval system