KEGG   Candidatus Nitrososphaera gargensis: Ngar_c04840Help
Entry
Ngar_c04840       CDS       T02305                                 

Gene name
adh2
Definition
NAD-dependent alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nga  Candidatus Nitrososphaera gargensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nga00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Ngar_c04840 (adh2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ngar_c04840 (adh2)
  Lipid metabolism
   00071 Fatty acid degradation
    Ngar_c04840 (adh2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Ngar_c04840 (adh2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Ngar_c04840 (adh2)
   00626 Naphthalene degradation
    Ngar_c04840 (adh2)
Enzymes [BR:nga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Ngar_c04840 (adh2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(358090..359130)
Genome map
AA seq 346 aa AA seqDB search
MAEKMRAMVLTKLAPIETRPLKLMSIDRPVAKGRNELMIEIEACGVCRSNLHLIEGDWKR
FGAPSHLPVVPGHEVVGVVKQVGSGVKKIKVGDRVGIQPLFSSCLQCEYCTTGKENLCES
AEITGETVQGGYAEYISALEEFVTPIPDNLDSEHAAPLFCPGITAYKAVKASEPAAGRTV
GIFGIGGVGHLAIQIAKMQGARVIAMSRAKKHLDLSKKLGADNVIVYQDSQGQFLKNLKK
EEGGLLDSAIVFAPSDKVIDTAIKSVKKGGTIVLGVLGNVSDFPTFEEKIVKGSVIGTMK
DMAELVSLASSSGLKVVIETHKLEEANEVLARLKKSQVEARAVLVP
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaaaatgcgggcaatggtcctgacaaagcttgccccaatagaaacccggccg
ctgaaattgatgtcgattgacagacccgtggcaaagggcagaaacgaactgatgatagag
atagaggcgtgcggcgtctgccggtcaaacctgcaccttatagaaggcgattggaaaagg
tttggcgcgccttcgcacctgccagtggttcccggccacgaagtggtgggcgtggtcaag
caggttggcagtggcgtgaaaaagatcaaggtaggcgacagggtaggaatccagccgctt
ttcagctcttgtcttcagtgcgaatactgcactaccggcaaagagaacctttgtgagagc
gccgagataacaggagagacagtacagggtggctacgccgagtacatttctgcgctagaa
gagtttgtcacgccgatcccggacaatctggactcagagcatgccgctccgctattttgc
cccggcataacagcgtacaaggcagtcaaggcaagcgagccggcggcaggcagaacagtc
ggcatttttggcatcggaggcgtcggccacctagcaatacagatagccaagatgcagggt
gcaagggtaatagcaatgtcaagggcgaaaaagcatcttgatctgtcaaaaaagctgggc
gcagacaatgtcattgtctaccaagattcgcaggggcagtttctgaaaaacctgaaaaag
gaggaaggagggctccttgacagcgcaatagtctttgcgccctctgacaaagtgatagat
accgccatcaagtctgtcaaaaagggtggcaccatcgtgctgggcgtgcttggcaatgtc
tctgattttccgacgtttgaagaaaagatagtgaaagggagcgtcatcggcacaatgaag
gacatggccgagctggtcagtttggcaagcagttccggcctgaaagtggttattgagact
cacaagctggaagaagctaatgaagtattggcaaggctcaaaaagtcgcaggtagaggcc
cgcgcagttctggttccctag

DBGET integrated database retrieval system