KEGG   Candidatus Nitrososphaera gargensis: Ngar_c16630Help
Entry
Ngar_c16630       CDS       T02305                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nga  Candidatus Nitrososphaera gargensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nga00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ngar_c16630 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ngar_c16630 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ngar_c16630 (trpB)
Enzymes [BR:nga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ngar_c16630 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1294223..1295428
Genome map
AA seq 401 aa AA seqDB search
MGGKFGRYGGKYIPETLAPAVEELESAYEKYRNDPEFQKDLSYYLTEYAGRPTPLYFAKN
LTEHIGGARIYLKREDLLHGGAHKTNNTLGQALLAKKMGKKRIIAETGAGQHGVGTAIAC
AVLGLPAEIYMGAKDVERQRLNVFRMELLGAKVHPVQSGSKTLKDAINEAIRDWIANVKT
TYYLIGSVVGPHPYPMMVRDFQSVIGYEIRQQMQELEGRLPDAMVACVGGGSNAMGSFYP
FVDDADVMLWGVEAGGEGIKSGKHSATLAAGSEGVLHGMFTYLLQDKCGQVIETHSISAG
LDYPGVGPEHAMLKDLNRARYAASTDDEAVEGFLALSRLEGIIPALEPSHAISYAMKLAK
EMDKDDIIVVTLSGRGDKDVQVVQDYLDNKGKNKKKKRHAK
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtgggcggcaaattcggcaggtacgggggcaagtacatacccgagacgctggcccctgca
gtcgaggagctcgaatccgcctacgagaagtacagaaacgaccctgaatttcaaaaggat
ctttcatactatcttactgaatacgccggcaggccgacccctctctactttgcaaagaac
ctgaccgagcatatcggtggcgctaggatttacctaaagcgtgaagacctgctgcatggg
ggcgcacacaagacaaacaacaccctcgggcaggcgctcttggcaaaaaagatgggcaaa
aagaggataatagcagagaccggagccggccagcatggagtgggcacggcaattgcctgc
gctgttctcgggctgcctgcagagatttacatgggggcaaaggacgtcgagcggcagagg
ctgaacgtctttcgcatggagctcctcggcgcaaaggtgcaccccgtccagtccgggagc
aagacgctcaaggacgccatcaatgaagcgatccgcgactggatagccaacgtgaaaacg
acctactacctcattggctcggtggtaggcccgcacccataccctatgatggtaagggac
tttcagagcgtcattggatatgaaataaggcagcagatgcaagagctggaaggcagactg
cctgatgcaatggtcgcatgcgtgggcggcgggagcaacgcaatgggctctttctacccg
tttgttgacgatgctgacgtaatgctgtggggggtggaagcagggggagaagggatcaag
tctggcaaacactcggcgactctggccgccggctctgaaggcgtgctccatggcatgttc
acctatttgctgcaggacaagtgcggccaggtcatagagacccacagcatttcggcgggc
ctcgactatcctggcgtgggaccggagcacgctatgctaaaggacctaaatcgcgccagg
tatgcagcatccacggacgatgaggcagtggagggctttcttgcgctctctagacttgag
gggataatccctgcgcttgagccatcacatgcaatctcgtatgccatgaagcttgcaaag
gagatggacaaggacgatatcatagtagtcacactttccgggcgcggcgacaaggacgtc
caagttgtacaagactatcttgataacaaagggaaaaacaaaaagaagaaaagacatgcc
aaatag

DBGET integrated database retrieval system