KEGG   Candidatus Nitrososphaera gargensis: Ngar_c16630Help
Entry
Ngar_c16630       CDS       T02305                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.1.2.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nga  Candidatus Nitrososphaera gargensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nga01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:nga00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:nga00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1294223..1295428
Genome map
AA seq 401 aa AA seqDB search
MGGKFGRYGGKYIPETLAPAVEELESAYEKYRNDPEFQKDLSYYLTEYAGRPTPLYFAKN
LTEHIGGARIYLKREDLLHGGAHKTNNTLGQALLAKKMGKKRIIAETGAGQHGVGTAIAC
AVLGLPAEIYMGAKDVERQRLNVFRMELLGAKVHPVQSGSKTLKDAINEAIRDWIANVKT
TYYLIGSVVGPHPYPMMVRDFQSVIGYEIRQQMQELEGRLPDAMVACVGGGSNAMGSFYP
FVDDADVMLWGVEAGGEGIKSGKHSATLAAGSEGVLHGMFTYLLQDKCGQVIETHSISAG
LDYPGVGPEHAMLKDLNRARYAASTDDEAVEGFLALSRLEGIIPALEPSHAISYAMKLAK
EMDKDDIIVVTLSGRGDKDVQVVQDYLDNKGKNKKKKRHAK
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtgggcggcaaattcggcaggtacgggggcaagtacatacccgagacgctggcccctgca
gtcgaggagctcgaatccgcctacgagaagtacagaaacgaccctgaatttcaaaaggat
ctttcatactatcttactgaatacgccggcaggccgacccctctctactttgcaaagaac
ctgaccgagcatatcggtggcgctaggatttacctaaagcgtgaagacctgctgcatggg
ggcgcacacaagacaaacaacaccctcgggcaggcgctcttggcaaaaaagatgggcaaa
aagaggataatagcagagaccggagccggccagcatggagtgggcacggcaattgcctgc
gctgttctcgggctgcctgcagagatttacatgggggcaaaggacgtcgagcggcagagg
ctgaacgtctttcgcatggagctcctcggcgcaaaggtgcaccccgtccagtccgggagc
aagacgctcaaggacgccatcaatgaagcgatccgcgactggatagccaacgtgaaaacg
acctactacctcattggctcggtggtaggcccgcacccataccctatgatggtaagggac
tttcagagcgtcattggatatgaaataaggcagcagatgcaagagctggaaggcagactg
cctgatgcaatggtcgcatgcgtgggcggcgggagcaacgcaatgggctctttctacccg
tttgttgacgatgctgacgtaatgctgtggggggtggaagcagggggagaagggatcaag
tctggcaaacactcggcgactctggccgccggctctgaaggcgtgctccatggcatgttc
acctatttgctgcaggacaagtgcggccaggtcatagagacccacagcatttcggcgggc
ctcgactatcctggcgtgggaccggagcacgctatgctaaaggacctaaatcgcgccagg
tatgcagcatccacggacgatgaggcagtggagggctttcttgcgctctctagacttgag
gggataatccctgcgcttgagccatcacatgcaatctcgtatgccatgaagcttgcaaag
gagatggacaaggacgatatcatagtagtcacactttccgggcgcggcgacaaggacgtc
caagttgtacaagactatcttgataacaaagggaaaaacaaaaagaagaaaagacatgcc
aaatag

DBGET integrated database retrieval system