KEGG   Candidatus Nitrososphaera gargensis: Ngar_c16720Help
Entry
Ngar_c16720       CDS       T02305                                 

Gene name
gap
Definition
glyceraldehyde-3-phosphate dehydrogenase, phosphorylating (EC:1.2.1.59)
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
nga  Candidatus Nitrososphaera gargensis
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ngar_c16720 (gap)
   01230 Biosynthesis of amino acids
    Ngar_c16720 (gap)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ngar_c16720 (gap)
Enzymes [BR:nga01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Ngar_c16720 (gap)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1302436..1303485
Genome map
AA seq 349 aa AA seqDB search
MVLVRVFINGYGNIGRRLASALSVDKEIQFIGVAKYTVDDKVKEALDNHYNVFVPKEMIG
AFKDKGYNVTGAVEEAVKQSDIVVDAAKEGGGYDNKKSLYEPMNKPAIFQGGEDRHGEHA
VADMIHNSRVNYSKAAGKTYVIQGSCNVSGMGRIMQPLIEKFGNRIKRYDVELIRRWADL
EDTKPVKDSIEWDRNPHHQEDVKDFIPSANLYVDAFKVPSRMMHLHQMFIRFSDRAPTKD
EILECFRNEFGVAIISSAKGTGDVRKKALELGFAHGDTNMVHIHQDIIRVQDDVVKIGYS
DDQTGMVIPENHMLLQSMVFKRPREEALKRTDNLFQVSKKRKILEEEFK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
ttggttttggtcagagtcttcataaatggttacggaaacataggccggcgtcttgccagc
gcgctctctgtcgataaagagatccagttcatcggggtggcaaaatatacagtagacgac
aaggtcaaggaagcgcttgacaaccactacaacgtttttgtcccaaaggagatgataggc
gcgttcaaggacaagggctacaacgtgacaggcgctgttgaagaagccgtaaagcagagc
gacattgtggtggacgccgcaaaggaaggaggaggctacgacaataaaaagagcctgtac
gagccgatgaacaagccggcgatatttcagggcggcgaagaccgccacggcgagcatgca
gtggcagacatgatccacaattcacgtgtaaactattccaaagccgcaggcaagacctac
gtcatacagggcagctgcaacgtctccggcatgggcaggataatgcagccgctgattgaa
aagtttggcaaccgaataaagcgctatgacgttgagctcataaggaggtgggcagacctt
gaggacaccaaacccgtcaaggactcgatcgagtgggataggaacccgcaccaccaagaa
gacgtcaaggactttatcccgtctgcgaatctttatgttgatgctttcaaggtgccatcc
cgcatgatgcacttgcaccagatgtttatccggttcagcgaccgcgcgccaacaaaggac
gaaatactggaatgctttagaaacgagtttggagtcgctataatcagctccgccaagggc
accggcgatgtcaggaagaaggcccttgagcttgggtttgcgcacggcgacaccaacatg
gtgcacatacaccaagacatcataagagtgcaggacgacgtagtcaagatcggctattct
gacgaccagactggcatggtgataccggaaaaccacatgctgctccagtccatggtcttc
aagcgtccaagggaagaagctctcaagaggactgacaacctctttcaggtttccaaaaag
cgcaagattctagaagaggaattcaagtga

DBGET integrated database retrieval system