KEGG   Candidatus Nitrososphaera gargensis: Ngar_c17620Help
Entry
Ngar_c17620       CDS       T02305                                 

Gene name
thrC1
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nga  Candidatus Nitrososphaera gargensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nga00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ngar_c17620 (thrC1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ngar_c17620 (thrC1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ngar_c17620 (thrC1)
Enzymes [BR:nga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ngar_c17620 (thrC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1369518..1370858
Genome map
AA seq 446 aa AA seqDB search
MDAYAIKKCINPACGLTYEINNDIYRCSCGSLLDIKYNKKPSRDLVETFYQRRNHGGNIY
NESGVWRFRDLINFAGIDTENFEECARVLVSLDGSEGRLSKPYNMSKAADYAEMNHDSFL
LQPEGYNPSGSFKDNGMSTAVTHAKMLGVKRIICASTGNTSASAAMYAANENMECDVYIP
KGEIAPGKLGQAFQFGAQVIQVQGNFDDALAASLKNAKETGGYTVNSVNPFRLEGQKTIV
YRVLEHLNWNPPDWIVYPGGALGNTSSCGKCLIELYEWGWIKKIPRMAIVNAEGANTFYE
LYNGLFEGKRLTWNDGRPDLAMVDRYYEHLDKKGIRPKTHATAIQIGKPANIVKALRALD
FTNGIVVQVSDKEMSDGMSIVGLNGFDCEMASGAVPAGVRKLRREGLIKRDDVVVGILTG
RQKDPGLAVEYHTNPNNMFAKPPTSH
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggacgcctacgcaatcaaaaagtgtatcaatccagcgtgcggtcttacttatgaaatt
aacaacgacatctaccggtgctcctgcggctcgctccttgatataaaatacaacaaaaag
ccaagccgcgatcttgtcgaaacgttctaccagcgacgcaaccacgggggcaacatttac
aacgaaagcggtgtatggcgcttccgcgaccttatcaattttgccggcattgacactgaa
aactttgaagaatgcgcacgtgttttggtctcccttgacggctctgaaggccgcctctca
aagccctacaacatgagcaaagcggctgactatgcagaaatgaaccatgattcgttcctg
ctccagcccgaaggctacaacccatccggctcgttcaaggacaatggcatgtcgaccgcg
gtgacccatgcaaagatgcttggagtaaaaaggataatctgcgcttccaccggcaatact
tcggcctctgctgcaatgtatgctgccaacgaaaacatggagtgcgatgtctatattcca
aagggcgaaattgcgcccggcaagcttggacaggcgttccagtttggcgcgcaagtgata
caggttcagggcaactttgacgacgctcttgcggcgtcgctcaaaaatgccaaagaaacc
ggcggatatactgttaattccgtaaacccattccgccttgaaggacaaaagactattgtc
tatcgggtcctagaacacctcaactggaacccgcctgattggatcgtatatcccggaggg
gcgcttggcaacacttcaagctgcggcaagtgcctgattgaactgtacgaatggggttgg
atcaaaaaaatcccgcgcatggcaatagtgaacgcagaaggcgcaaacacattctacgaa
ctctataatggcttgttcgaaggcaagcggctgacctggaacgacggtaggccggatctt
gcaatggttgatcgctactacgagcatttggacaagaaaggcatcaggccaaagacccat
gcaacggctatccagataggaaaacctgccaacattgtaaaagcactgcgcgcgctcgat
tttacaaatggcatcgttgtgcaagtaagcgacaaggaaatgagcgacggtatgtcgata
gtcgggctcaacggctttgactgtgaaatggcgtctggagctgtgccagccggcgtgaga
aagctacgcagagagggcttgataaaacgcgatgatgtggtggttggcatacttactgga
agacagaaggatccggggcttgcagtagaatatcataccaatccaaataacatgtttgca
aagccgccaacaagccactag

DBGET integrated database retrieval system