KEGG   Candidatus Nitrososphaera gargensis: Ngar_c20250Help
Entry
Ngar_c20250       CDS       T02305                                 

Gene name
adh3
Definition
NAD-dependent alcohol dehydrogenase (EC:1.1.1.1)
Organism
nga  Candidatus Nitrososphaera gargensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1587298..1588359)
Genome map
AA seq 353 aa AA seqDB search
MQMLSARIHQYQRPLVVERVPKPSNVHGEAVLVRVGAAGLCHSDLHLINGEWKDAIPLAL
PKIPGHENAGWVEEIGNTVPEGLFSKGELVAIFGGWGCGICTFCKRGDEQLCVAPQWPGL
SQRDGGYSEYILVPSYRFLVKVPKKGRLTPEELAPLTDAGLTPYRAVKKVTHMLGPGTNI
AIVGMGGLGAYGIQYARLLAPHSTVIAVDRKDKKLSLAENFGADRTVNSATTRNIRDEVL
ELTDGRGIDVVVDTVGAENTIADSVRMLAKGGALVVVGLFGSQIKIPLLPAIVNEYQVIA
SLWGNYNELKEVIELASQRKIKHAYQSFSLKEINQAIDQLRQGQIIGRAVIVP
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatgctctctgcgcgcattcaccaataccaaagaccacttgtagttgaaagagtt
ccaaagcctagcaacgttcatggcgaagctgtccttgtcagggtaggcgcagccggcctc
tgccacagtgaccttcatctgataaacggagaatggaaagatgcaatcccgctggcgctg
cccaagattcccggtcacgaaaacgccggctgggtcgaagagattggcaatacggtgccg
gaagggctgttcagcaagggcgagcttgttgcaattttcggtggatggggctgcggcata
tgcacgttctgcaaaaggggtgacgagcagctctgtgttgctccgcagtggcccggcctg
tcgcagcgcgatggcggatactccgaatacatacttgtgccttcgtacaggttccttgtc
aaggttccaaaaaagggcagattgactcctgaagagcttgcgccgctgacagacgcagga
ctcaccccgtacagggcagtcaaaaaggtgacgcatatgcttggtcccgggacaaacatc
gcaatagtcggaatgggcggccttggtgcgtatggcatccagtacgccaggctccttgcg
ccacactcgactgtcattgcagtggaccggaaagacaaaaagctcagccttgccgagaat
tttggtgccgatcgcacagtaaactcggcaaccacacggaacatacgtgatgaggtgtta
gagctgacagacggcagagggatcgatgtggtagttgacaccgttggtgcagagaatacg
atagccgattcggtcaggatgctggcaaagggcggtgcgctggtggtagtaggcctgttt
ggcagccagataaaaatcccgctcttgccagcgatagtaaacgagtaccaagtgatcgca
tcgttgtggggaaactataacgagctgaaagaagtgatagagctagccagccagcgcaaa
ataaagcatgcctaccagagcttttcattgaaggagatcaaccaagcaatagaccagcta
agacaggggcagatcataggaagggcggtaatcgtcccatag

DBGET integrated database retrieval system