KEGG   Candidatus Nitrososphaera gargensis: Ngar_c21810Help
Entry
Ngar_c21810       CDS       T02305                                 

Gene name
cofE1
Definition
F420-0:gamma-L-glutamate ligase (EC:6.3.2.-)
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
nga  Candidatus Nitrososphaera gargensis
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nga00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Ngar_c21810 (cofE1)
Enzymes [BR:nga01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     Ngar_c21810 (cofE1)
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     Ngar_c21810 (cofE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1696936..1697673)
Genome map
AA seq 245 aa AA seqDB search
MIQVIPVRISADIKPHDELDAIILGAAGQEIQNGDVLVVAHKIVSKAEGRLVSLADVKPS
DKALRMAKEHGKDSRIMELILRESAQILRAKDGIIISETKHGFVCANAGVDQSNVEGDSA
VLLPIDPDRSASRLRDAVKKKAGKEIAVVITDTFGRPFREGQTNIAIGVAGLDPIKSYVG
SRDMYGRKLRVSEIAVADEMASAAELVMGKAEGVPVAIIRGYKFEKSASSSAKALQRPRE
RDLFR
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
ttgatacaggtaatccccgtcaggatttctgcagacatcaagccacacgacgagcttgac
gccattatacttggagcggcaggacaagagatccaaaatggggacgtgcttgtcgttgcg
cacaagatagtgtcaaaggcagaagggcgtctggtcagccttgcagacgtcaagccttca
gacaaggctctcaggatggcaaaagagcacggcaaagactctagaataatggaattgata
ctgagggagtctgcgcaaatcctgagggcaaaagatggcattatcatatcggaaacaaag
catggctttgtgtgcgcaaatgccggcgtggaccagagcaatgtggaaggcgattcagct
gtattgttgccaatcgaccctgacaggtctgcaagcaggctccgggacgcagtaaagaaa
aaagcaggaaaagaaattgcagtcgttatcaccgatacttttggccggcctttccgggag
ggccagactaacatcgcaattggagtcgctggcttggaccccatcaagagctacgtcggg
tcgcgcgatatgtacggcaggaagctcagggtgagcgagatcgcggtggcagacgaaatg
gcatcggcggcagagcttgtaatgggcaaggctgaaggcgtgcctgtagcaataattcgt
gggtataaatttgaaaaatcagcaagctcctctgccaaggcattacagaggccaagagag
cgggatctttttaggtaa

DBGET integrated database retrieval system