KEGG   Candidatus Nitrososphaera gargensis: Ngar_c21850Help
Entry
Ngar_c21850       CDS       T02305                                 

Definition
Mg-chelatase subunit
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
nga  Candidatus Nitrososphaera gargensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nga00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ngar_c21850
Enzymes [BR:nga01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Ngar_c21850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1701447..1703081)
Genome map
AA seq 544 aa AA seqDB search
MVHRSYTTKPKYTEIMPGVPEDYKQVKTLGDLLKINYKHVTVEEQMRGNLIAKLKKGEHP
YPGIIGYDDDVIPAVNRAILSGHDLLLVGQIGQAKTKIAEAIAKNLLSPIPVVRGTVTND
IPTSIPEDQLTALLSDSEVVRTQPEFTVSPECEDIIRSNKLETKIDWISGADRYKYILST
PDISVKDLVGQIDAIKIAKKGVELYSMESYSAGQLLQARHGILCIDELPVLDPRKQVSLL
SVLQEGKFTTGAYPAVFKPDVKIIATANPIDYTHSGKIIEPLFDRLRSHVDTHYPRTVED
EMLITVQESRIADAKNVMLPVFIVRTIAKITQMTRAHHDVNHNKGVSVRMSVHSMEMMIG
EAERTRSITFGVKAIPRFCDIHCIHQSSKFELAEMEDTRENRKNVLDSIIESALKEVALE
YIQKLAPEQLIKVKNDFAKNKAFQVSQALVGSGGISKSPDYESQLAKFPGLKAAVNETIG
TVKDEQKQLVERAKQLGIRTDSILFTPDLNGEFTAAVTEVILEGLRHTQPPILDRKDNSY
GLAQ
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggtccaccgctcttataccaccaagccaaaatacactgaaattatgcccggtgtcccc
gaagactacaagcaggtaaagacgctcggcgatcttttgaagataaactacaagcatgtc
acagttgaagagcagatgcgcggcaaccttattgccaagttgaagaagggcgagcacccg
tacccaggcatcattggttatgacgatgatgtcattcctgcggtcaacagggccatttta
tcaggtcatgatctcttgcttgtcggccagatcggtcaggcaaagaccaagatcgcagag
gccatagcgaagaacctcttgtcgccaatcccagttgtgagggggactgtgacgaatgac
atcccgacctcgatccctgaagaccagctgaccgcccttttgtcagactctgaggtcgtg
cgcacccagcccgagttcaccgtttcgccagagtgcgaagacattatcagatcaaacaag
ctggaaacaaagatagactggataagcggcgcggacaggtacaagtacattctatcgaca
ccggacatttccgttaaagatcttgtaggccagattgatgccatcaagatagcgaagaaa
ggcgtcgagctctatagcatggaatcgtattccgccggccagctgttgcaggcaaggcat
ggcattttgtgcatcgacgagctgccagtgctcgacccgcgcaagcaggtgtccctgcta
agtgtcctgcaggaaggcaagttcaccaccggcgcttatcctgccgtcttcaagccggat
gtcaagataatcgcgacggcaaacccgatcgactatacccactcgggcaagataattgag
cccttgtttgacaggctcaggagccacgttgacacccattacccgaggactgtggaagac
gagatgctcataacagtgcaggagtcgaggattgctgacgccaagaacgtgatgctgcct
gtctttatcgtaaggacgatagccaagataacgcagatgacacgtgcccatcacgatgtc
aaccacaacaagggcgtgagcgtcaggatgtcggtgcattcgatggagatgatgataggg
gaagccgagcgcacccgctctatcacttttggcgtcaaagcaatcccgcgcttttgcgac
atacactgcatacaccagtcaagcaagttcgagcttgcagagatggaggacacgcgggag
aataggaaaaatgtgctcgattcgatcatagagagcgcgctcaaggaagtggcgcttgaa
tacatacaaaagcttgccccagagcaactgataaaggtaaagaacgactttgcaaagaac
aaagcgttccaagtgtcgcaggcactggttggcagcggcggcatcagcaagagccctgac
tatgaatcgcaactggccaagttccccgggctcaaggctgcagtcaacgagacgatcggc
actgtaaaggacgagcaaaagcagctggtcgagagagccaagcagcttggcatcaggact
gacagcattttatttacacccgatctgaacggcgagttcaccgctgcagtgaccgaagta
atactagaggggctgcgccacacgcagccgccgatcctggatagaaaggacaacagctat
ggactcgcacagtag

DBGET integrated database retrieval system