KEGG   Candidatus Nitrososphaera gargensis: Ngar_c22900Help
Entry
Ngar_c22900       CDS       T02305                                 

Gene name
acsA1
Definition
(RefSeq) acetate--CoA ligase (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nga  Candidatus Nitrososphaera gargensis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ngar_c22900 (acsA1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ngar_c22900 (acsA1)
   00620 Pyruvate metabolism
    Ngar_c22900 (acsA1)
   00640 Propanoate metabolism
    Ngar_c22900 (acsA1)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Ngar_c22900 (acsA1)
   00680 Methane metabolism
    Ngar_c22900 (acsA1)
Enzymes [BR:nga01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Ngar_c22900 (acsA1)
Lipid biosynthesis proteins [BR:nga01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Ngar_c22900 (acsA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1782899..1784842)
Genome map
AA seq 647 aa AA seqDB search
MSSPSKLYEESGRIKVNVTPGRRLEKVSKEALAEPEKFWAEQARNLVWFKEWDRVLDWKP
PFARWFVGGQLNASVNCLDRHVKTDTKNKTAIIWEGESGETRTLSYFQLYRQVNKFANVL
KSLGVGKGDRVTIYMPMVPELPIAMLACARIGAIHSVVFSGFSSQALVDRANDAQSKIII
TADGGVRKGRLIELKKVVDESLPSIQSIDHVIVLKRAGNEVGMGPRDLWWHDLMEGAKTY
CPPEPVESTHPLYILYTSGTTGKPKGVMHGTGGYLTHLYATAKWVFDFNKQDIFFCTADI
GWVTGHSYIVYAPLMHGATEIMYEGAPDHPRPDRYWAIVEKHGATILYMTPTALRMYMKY
GDVVPNSFDLSSLRLLGTVGEPINPEVWMWYFKTIGKEICPIVDTWWQTETGGIMLSMCT
GIETIPMKPGSATFPVPGVDAAVVDENGKPVPPGTKGYIVVRRPWPGMLLTLWGDDEKYK
QVYWSKFAGMYYPGDYAMIDQDGYLWLLGRADDVLKVAGHRLGTMELESAFVSHKAIAEA
AVTSKPNNTKGESIIAFLVPKEGFTHSDDMRTEIVAHIRNTVGPIATPDEVYFVNKLPKT
RSGKIMRRLLKSIACGDKIGDITTLEDGAAIDEVKQAYEDLKKVVRS
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgagcccttcaaagctatatgaagagagtggcagaatcaaggtaaacgtcacgcca
gggaggcgtcttgaaaaggtctcaaaagaggcgctggcagagccggaaaaattctgggca
gagcaggccagaaacttggtgtggttcaaagaatgggatcgggtgcttgactggaagccg
ccgtttgcccgatggtttgtcggaggccagctcaacgcgtctgtcaactgccttgacagg
cacgtcaagacagatacaaagaacaaaactgcaataatatgggagggtgaaagcggggag
acaaggaccctttcctatttccagctttaccggcaggtgaacaagtttgccaatgtcctc
aagagcctgggcgtcggcaagggcgacagggtgacgatatacatgccgatggtgccagag
ctgcccattgcgatgcttgcgtgcgcaaggataggcgcgatccactctgttgtattttct
ggcttttcttcgcaggcgctggtagacagggcaaacgacgcacagtccaagataatcatc
accgctgacggcggtgtaaggaagggtaggctgatcgagctgaaaaaagtggtagacgag
tcgctgccctcgatccagtcgatcgatcatgtcattgtgctaaagcgcgccggcaacgag
gtcgggatggggccgagggatctgtggtggcacgatctgatggaaggcgccaagacctac
tgcccaccagagccggtcgaaagcacccacccgctctacatcttgtatacgtccggcacg
acaggcaagcccaaaggtgtaatgcatggaaccggcggctaccttacgcacctgtacgct
actgcaaagtgggtatttgactttaacaagcaggatatctttttctgcactgctgacatt
ggctgggttacaggccacagctacatcgtctacgcgccgctgatgcatggcgcgacagag
ataatgtatgaaggcgctcccgaccacccaaggccagaccggtactgggccatcgtggaa
aagcacggggcaaccatcctgtacatgacgccgactgcgctccgcatgtacatgaagtac
ggcgacgtagtcccaaactcgtttgacctctcttcgctcaggctgcttggcaccgtgggc
gagcccatcaacccggaggtctggatgtggtatttcaagacgataggaaaagagatctgc
cccatagtcgacacctggtggcagacagagaccggcggtataatgctcagcatgtgcaca
ggcattgagacgatcccaatgaagcccggctcggcgaccttccctgtgcccggggtcgac
gcggcagtagtcgacgaaaacggcaagcctgtcccgccggggacaaaaggctacatcgtg
gtgcgcaggccgtggccggggatgctgctgacgctctggggtgacgacgaaaaatacaag
caggtatactggagcaagttcgccggcatgtactacccaggtgactatgcgatgatcgat
caggatggctacctctggctgctgggcagggcagatgacgtgctcaaggtagccggccac
aggctaggtacgatggagcttgaaagcgcgtttgtctctcacaaggccatagccgaagcg
gccgtgaccagcaagcccaataacaccaagggcgaatcgataatcgcgttcttggtgcca
aaagaaggctttacgcattctgacgacatgcgcacagagatcgtagcacacatcaggaat
accgttgggcctatcgccacgccggacgaagtatatttcgtgaacaagctccccaagacc
cgcagcggcaagataatgcgccggctcctaaaatcgattgcatgtggcgacaagataggc
gacatcaccacgcttgaagacggggctgctatcgatgaagtaaagcaagcctacgaagac
ttgaaaaaagtggtgcgctcctag

DBGET integrated database retrieval system