KEGG   Candidatus Nitrososphaera gargensis: Ngar_c25050Help
Entry
Ngar_c25050       CDS       T02305                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
nga  Candidatus Nitrososphaera gargensis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nga00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ngar_c25050
Enzymes [BR:nga01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Ngar_c25050
Peptidases [BR:nga01002]
 Cysteine Peptidases
  Family C44
   Ngar_c25050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1951771..1952667
Genome map
AA seq 298 aa AA seqDB search
MLLSGGLDSSILASILHPKYSVAAGFGSDAPDLAHARQVAGKYSGRHVEVVFDQNRMAEL
VEQVIQVFKTFDPIEIRNSAVALAGMEQAKSDGHSAIMTGDGGDELFAGYNYLARYYSDA
QKLDLELRRLWQIMHFSSRKLGEHIGVKVKTPFLDGEFISFAKSIGVSEKVGEHNGKKWG
KLILRRCFETTLGDLVWRQKLAQEQGAATGKYQKYVEEMIDDLTFANKAKIAKELDNVTI
RSKEHLHYYAIFRSYFPPPKEEEREVDCESRCPECRGCMARDGRFCRTCGAFPVTPSL
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
ttgctgctctcaggcgggcttgatagcagcatactggcaagcatactgcatccaaaatat
tcggtggctgcgggatttggctctgatgccccggaccttgcccacgcaaggcaggttgcg
ggaaaatacagcggaaggcacgtcgaagtcgtatttgaccagaacaggatggcagagctg
gtcgagcaggtcatacaggtcttcaagacgtttgacccgatagagatcaggaattcggca
gtcgctcttgccggcatggagcaagcaaaaagcgacggccactccgccataatgacaggc
gacgggggcgacgagctgttcgcaggctacaactatcttgcccggtattactctgacgcg
caaaagctggatttggaattgcgccggctctggcagatcatgcatttttcgtcaagaaag
ctgggcgagcatatcggtgttaaggtaaagacccctttccttgacggggaatttatatcg
tttgcaaagtcgataggcgtcagcgaaaaggttggcgagcataatggaaaaaagtggggc
aagctcatcctcaggaggtgttttgagactacacttggcgaccttgtttggaggcaaaag
cttgcgcaggagcagggagcggccactggcaaatatcaaaaatatgttgaagaaatgata
gatgacctgacctttgcaaacaaggcaaagatagcaaaagagctggacaacgtcacgata
aggagcaaggagcacctgcactactacgctattttccgaagctactttccgccgccaaag
gaagaagaaagagaagtggattgtgaatcgcgctgcccggaatgccgcggctgcatggcg
cgggacggtaggttctgcaggacgtgtggcgcgtttcctgtcacgccgtcactttga

DBGET integrated database retrieval system