KEGG   Candidatus Nitrososphaera gargensis: Ngar_c26100Help
Entry
Ngar_c26100       CDS       T02305                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nga  Candidatus Nitrososphaera gargensis
Pathway
nga00860  Porphyrin and chlorophyll metabolism
nga01100  Metabolic pathways
nga01110  Biosynthesis of secondary metabolites
nga01120  Microbial metabolism in diverse environments
Module
nga_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:nga00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ngar_c26100 (hemD)
Enzymes [BR:nga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Ngar_c26100 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AFU59532
UniProt: K0ILK5
Position
complement(2028105..2028905)
Genome map
AA seq 266 aa AA seqDB search
MPGLLKNKIIAITRSERDAKEFSELVSKQGGRPIALPTIEIVPKEAEVGQEFLEKLRKEK
HDYCAFMSPQAVSVLFDLAGNEAVLSALKSTTVIAVGPKTKEVLQERGVKVGLVPEKFSS
AGLVELLSSSIKEPAGKKIIIPRSGAANEYASEALGRLGIKVDEVLLYNVRTSATITPVW
HEFASLLRQKKVDAIIFTSASNVSSFFEIMGIVSAASGSLLQLDELTKVVSIGPFTSREL
EKRQIKCFQAEEHTVMGALKLATQIV
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgccggggctgctaaaaaacaagatcattgcaatcaccagaagtgagcgcgacgcaaaa
gaattttcagagctggtgagcaaacagggaggcaggccaatagcgctcccaaccatagag
atagtgcccaaggaggcagaggttggacaagaattcctagaaaagttacgaaaggaaaaa
cacgactattgcgcgttcatgagccctcaggcggtgagcgtgctctttgaccttgcaggc
aatgaagcggtgctgtcggcgctcaagtccaccacggtaatagcagtcggaccaaagaca
aaagaggtcttgcaagagcggggcgtaaaggtcgggctcgtgccagaaaaattctcgtcg
gctgggcttgtcgaactcttgtcgtcgtcgataaaagagcctgctgggaaaaagataatc
atcccccggagcggcgctgcaaacgagtatgcctcagaggcgcttggccgccttgggatt
aaagtcgacgaagtcctgctctacaacgtgcgcacaagcgctaccataacgccggtctgg
catgaatttgccagtcttttgcggcagaaaaaggtggacgcgatcattttcacgagtgct
tcaaacgtcagctcgttctttgagataatgggcatagtgtcagccgcctcaggtagtctt
ctgcagctagacgagctcactaaggtggtatcgataggcccttttacaagcagggagctg
gagaagaggcagatcaaatgctttcaagcggaggagcacacagtcatgggcgcgctcaag
cttgcaacgcagatcgtgtaa

DBGET integrated database retrieval system