KEGG   Candidatus Nitrososphaera gargensis: Ngar_c26800Help
Entry
Ngar_c26800       CDS       T02305                                 

Gene name
adh4
Definition
(GenBank) NAD-dependent alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nga  Candidatus Nitrososphaera gargensis
Pathway
nga00010  Glycolysis / Gluconeogenesis
nga00071  Fatty acid degradation
nga00350  Tyrosine metabolism
nga00625  Chloroalkane and chloroalkene degradation
nga00626  Naphthalene degradation
nga01100  Metabolic pathways
nga01110  Biosynthesis of secondary metabolites
nga01120  Microbial metabolism in diverse environments
nga01130  Biosynthesis of antibiotics
nga01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ngar_c26800 (adh4)
  Lipid metabolism
   00071 Fatty acid degradation
    Ngar_c26800 (adh4)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Ngar_c26800 (adh4)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Ngar_c26800 (adh4)
   00626 Naphthalene degradation
    Ngar_c26800 (adh4)
Enzymes [BR:nga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Ngar_c26800 (adh4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: AFU59601
UniProt: K0IE04
Position
2083401..2084453
Genome map
AA seq 350 aa AA seqDB search
MKAARIIKTKEPLEIKDVGVPKPKNDQVLVRVESAGVCHSDLHLWEGGYAGPQGVFMKVE
DRGVKFPLTPGHEIAGTIEEMGESVTGFSKGEKVLVYPWIGEGTCPACRVGEENVCDAPR
SLGIYQDGGYSEMVLVPSHKYLVKLQGLDPNSAASLACSGLTAYTAVKKAGAQPGDTLVI
VGAGGLGLMAVQIAKSITNARIAIVDIDDKKLAEAKRLGAHEVINSGASDSVKGVKDITN
NFGAEAVIDFVNNAKTAPNSLNMLRKRGRLVMVGLFGGSLELNLPLIPLRAFTLTGAYTG
KFADLVELVALARMDKIQSVVSRKFTLDQANSALEELKSGKIIGRAVINP
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgcacggataataaagacaaaagagccgcttgaaatcaaggacgtcggcgtt
ccaaaaccaaagaacgatcaggttcttgtaagggttgaaagtgcaggcgtatgtcacagt
gatctgcacctgtgggaaggtgggtacgccggaccgcagggcgtgtttatgaaggttgag
gaccgcggagtaaagttcccactcacccccggccatgaaattgccggcacgattgaagag
atgggcgaatcggtcactggcttttccaagggcgagaaggttctggtctatccatggatt
ggcgagggcacatgccctgcatgcagggtgggcgaggagaacgtctgcgatgccccgcgc
agcctcggcatataccaagacgggggctactctgaaatggtgctcgtgccaagccataag
tatctggtaaagctgcaggggctcgaccccaactctgccgcgtcgcttgcatgctctggc
ctgacggcatacactgccgtaaagaaggcgggcgcgcagccaggcgacacgcttgtcatt
gtaggggctggcggccttgggctcatggcagtgcagattgcaaagtcgatcacaaacgca
aggatcgcgattgtcgacattgacgacaagaagctggcagaggcaaagaggctgggagcc
cacgaagtgatcaactcaggggccagcgactctgtcaagggtgtcaaggacatcacaaac
aactttggcgcagaggctgtcattgactttgtgaacaacgccaagacggcgccaaactcg
ctcaacatgctgaggaagaggggccggctggtcatggtcgggctgttcggcgggtcgctt
gagctaaacttaccactcattccattgcgcgcattcacgctgactggcgcctacaccggc
aagtttgcagatctggtagagctggtggcgcttgcaagaatggataagatccagtcggta
gtatcgagaaagttcacgcttgatcaggcaaacagcgcactagaagagctgaaatcaggc
aagataattggaagggcagtaatcaatccctag

DBGET integrated database retrieval system