KEGG   Candidatus Nitrososphaera gargensis: Ngar_c28320Help
Entry
Ngar_c28320       CDS       T02305                                 

Gene name
glmM
Definition
phosphoglucosamine mutase (EC:5.4.2.10)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
nga  Candidatus Nitrososphaera gargensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ngar_c28320 (glmM)
   00030 Pentose phosphate pathway
    Ngar_c28320 (glmM)
   00051 Fructose and mannose metabolism
    Ngar_c28320 (glmM)
   00052 Galactose metabolism
    Ngar_c28320 (glmM)
   00500 Starch and sucrose metabolism
    Ngar_c28320 (glmM)
   00520 Amino sugar and nucleotide sugar metabolism
    Ngar_c28320 (glmM)
  Nucleotide metabolism
   00230 Purine metabolism
    Ngar_c28320 (glmM)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Ngar_c28320 (glmM)
Enzymes [BR:nga01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Ngar_c28320 (glmM)
    5.4.2.8  phosphomannomutase
     Ngar_c28320 (glmM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2204808..2206181)
Genome map
AA seq 457 aa AA seqDB search
MQAAARQRLFGTNGVRGVYGQELTHDLVIDLCYALGTYFGRGPIVVGHDGRKSSPVLSRL
VRATLNSAGLDTANAGLVPTPCLQYAAKRLGYRGGIMITASHNPPQYNGIKPTASDGVEI
SREDELRVEDIYYSKKFAKIDGTGRDSIDDSVISKYIDAVLLLVDADKIRQKKLTVAMDT
GNGAQAAVAPLVAKKLGCKVIVINGNIDGEFPARGSEPTPDNLGVLAETVRSARADFGVA
YDGDGDRSIFCDDTGAIYMGDKTGALFIRHLLAGRHKGSEVVCPINTSMILEKVAEQAGS
KVVYTKVGSVEVSREMVRRRSPLGLEENGGFMYGALNEVRDGVMATALALDMLAASAVDM
SFSQHIAQLPQTFQYKSKFACPSREVVDKVIQACKDHGSPKKVETLDGAKIWIDEETWVM
VRPSGTEPLIRMYAESTDKSLLDSKVDEYCRLVQSKM
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcagcggccaggcaacggctatttgggacaaacggcgtacgcggggtctacggg
caggagctcactcacgatctggtaatcgacctatgctacgcactgggcacctactttggc
aggggcccgatcgtagttgggcacgacgggcgcaagtcaagcccagtcctgtcaaggctc
gtcagggcaactctcaactctgccggacttgacacagccaacgccggcttggtgccaact
ccgtgcctgcagtatgctgcaaagcgccttgggtaccgcgggggcattatgataaccgcg
tcccataacccaccccagtataacgggatcaagcctaccgcttctgacggagttgagatt
tcccgggaagacgagttgagagtcgaggacatttactattcaaaaaagtttgcaaaaata
gacggcactggccgtgattccattgacgacagtgtcataagcaagtacatcgacgcggtg
cttttgctggtcgatgctgacaagataaggcagaaaaaactcacggtggcaatggatacg
ggcaatggcgcgcaggccgccgtcgcgccgcttgtagccaaaaagctgggctgcaaggtg
atcgtgataaacggcaacatcgacggcgagttcccggcgcgcgggtcagagccgacccct
gacaaccttggggtgcttgcagagactgttaggtctgcaagggccgactttggagtcgcg
tacgacggcgacggcgacaggagcatcttttgcgacgacacgggcgctatatacatgggc
gacaagaccggcgcgctctttatcaggcacctgctagcaggccgacataagggatctgaa
gtcgtctgccctataaacacttcaatgattttggaaaaggtggcagagcaggccggctcc
aaggtagtctacacaaaggttggaagcgtcgaagtatcaagggagatggtgaggcgcaga
tctccgctcgggcttgaagaaaacggcggctttatgtacggcgcactcaacgaagtgagg
gacggggtgatggccaccgcgcttgcgcttgacatgcttgccgcgtctgccgtcgatatg
tcgttttcgcagcacattgcgcagctgccacagacgttccagtacaagagcaaatttgcg
tgcccttcaagggaggtggtcgacaaggttatccaagcctgcaaagaccatgggagcccg
aaaaaggtcgagacgctggacggtgccaagatatggatagacgaggagacctgggtcatg
gtgaggccgagcgggactgagccccttatcaggatgtatgcagaatcgaccgacaagtcg
ttgcttgattcgaaggttgacgagtactgcaggctggtccagtctaaaatgtaa

DBGET integrated database retrieval system