KEGG   Candidatus Nitrososphaera gargensis: Ngar_c30660Help
Entry
Ngar_c30660       CDS       T02305                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
nga  Candidatus Nitrososphaera gargensis
Pathway
nga00340  Histidine metabolism
nga01100  Metabolic pathways
nga01110  Biosynthesis of secondary metabolites
nga01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nga00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Ngar_c30660 (hisD)
Enzymes [BR:nga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Ngar_c30660 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AFU59982
UniProt: K0IM42
Position
2400041..2401333
Genome map
AA seq 430 aa AA seqDB search
MKIINVAEPAIGAARLRKATAIPDSLFADAMAIMKSVAEHGDSAVLDYTAKFDGVRLDSL
KVGEHEIKHAYRQVTKEQVRAVRLMKERLAKSELAVLKQLKGIAVSAEGVRINRMVKPVA
SVGCYIPGGKARYPSTVVMCAVPAKAAGVKRIVAVSPPMKDGTIDPLTLVAADICGVDEF
YKAGGAQGIAALAYGTQSIKPVSKIVGPGGMFVTAAKLIASGNVSTDMVAGPTELLIYAD
TTADPRLVAVDLISQSEHSTDTICGLVTTSEKLASQVHAQVQSLVEKITRSDIVKSSLEN
NGFIAVCKNESECIEFVNEFAPEHLEIMCKNADAVAKKIDSAGLVLIGQYAPSSASDYSL
GSNHVLPTLGFGKSRASLSVLDFIKIVNKVKVSKAGLAKVDRSVKEMAVAEGLLNHYEAV
RARTEDDEEE
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaagataatcaatgtcgccgagccagctattggggccgcgcggctgcgcaaggcaacc
gcaatcccggactcgctttttgcagacgcgatggcgataatgaaaagtgtggcagagcac
ggcgactcggctgttcttgactataccgcgaaatttgatggtgtaaggcttgactcgctc
aaggtgggcgagcatgagataaagcatgcatacaggcaggtcacaaaagagcaggtcagg
gcagtcaggctcatgaaagagcgattggcaaagagcgagctggcggtgcttaagcagctg
aagggaatcgcggtgtcggcagaaggcgtaaggataaatcgcatggtaaagccagtcgca
agcgtcgggtgctacatacccggcggaaaggcacgctacccaagcacggttgtcatgtgc
gcggtgcctgccaaggcagccggcgtaaagaggatcgtcgcggtgtcgcccccaatgaag
gatggcaccatcgacccactgacgctggtcgcagcagacatttgtggagttgatgaattc
tacaaggcgggtggcgcgcaggggatagccgcgcttgcctacggcacgcagtcgataaaa
ccggtgagcaagatagtaggccccggcggcatgtttgtgacggctgcaaaactaatcgct
tctggcaatgtttcaacagacatggtggccggcccgacagagctgctgatatacgccgac
acgacagcagacccgcggcttgtggcagtcgacctaatctcgcagtcagaacacagcacc
gacacgatctgcggcttggtgacaacgtctgaaaagctggcgtcacaggtgcatgctcaa
gtacaatcgctggtcgaaaagatcacccggtcagacattgtaaagtccagcttggagaat
aatgggtttatcgccgtctgcaagaacgaaagcgagtgcatcgagtttgtgaacgagttt
gcgccagagcacctagagataatgtgcaagaacgccgatgcggttgcaaaaaagatagat
tctgcagggctcgtgctgatagggcagtacgcgccgtcgtctgcaagcgactactcgctt
ggctccaaccatgtgctcccgaccctcgggtttggcaagtcgcgcgcatcgctgtcagtg
ctcgactttataaaaattgtaaacaaggtcaaggttagcaaggctgggcttgcaaaggta
gacaggtcggtcaaggaaatggcggtcgcagaggggctcctgaaccactacgaggcggtg
agggcgaggacagaggatgatgaagaagaataa

DBGET integrated database retrieval system