KEGG   Candidatus Nitrososphaera gargensis: Ngar_c34990Help
Entry
Ngar_c34990       CDS       T02305                                 

Gene name
acsA2
Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nga  Candidatus Nitrososphaera gargensis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:nga01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:nga00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:nga00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:nga00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:nga00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2749685..2751583
Genome map
AA seq 632 aa AA seqDB search
MPAEEKYVFTPLPELMAKSNIARFMNRHGISGWRQLVEKANSDIGWYWDAVNEDLSIDWF
QRYDKTFDSSAGIPWTKWFVNGKCNIVANAVDKHAKSQPDKVAYIFADEHGSKKITYGEL
DEQVSRLAGALAGAGIKKGDVVAIYMPMIPEAFYAIFACSKMGAVHTTIFSGFSAQALRS
RLIDSNAKLLITADTVSRRGKEIHLAGQWQKAVQGTKVRRIITVGRDYQDFVKSAPRAKT
EVMDAEDPLFILYTSGTTGEPKGTLQVHGGFTVVAAQQTAYLIDMKPDDVLFWYADIGWI
TGQVWVVYGSPIIGGTALVYDNTLDYPTADAWCRLIEDHKVSIFGAAPTAIRLFMKKNVQ
AGNYDFSSLRVLAATGEPINAEAWQWYFENVGKKRCPVINLSGGTEIGGAILSALPVMPL
KECTVGCQIPGFDADVFDDSGKRASEGYLVIKKPWPSMTRGLLNNPGRFIDTYWSKYKDV
WYHGDIVLVDPDGLWYMRGRADDVIKVAGHRIGTAEVEAAAASHPAVAEAVAVGRPDELK
GEAIVVCVVVKDDGSHSTNGNNNNNLKQEIIRCVEGSIGKFARPEEVRIVAELPKTRTGK
LVRRLVRAKVAGENIASQDLSTVENPWSLDGI
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
ttgcctgccgaggaaaagtatgtgttcaccccattgccagagctcatggctaaaagcaac
attgcgcgctttatgaacaggcacggcatttcgggctggcgccagctggtagagaaagcc
aacagcgacattggctggtactgggacgcagtcaatgaggatctcagcatcgattggttc
cagagatacgacaagacgtttgattcgtctgcaggcattccttggacaaagtggttcgta
aacggcaagtgcaacattgtagccaatgcggtcgacaagcacgcaaagagccagcctgac
aaggtggcgtacatttttgcagacgagcatggatctaaaaagatcacgtatggcgagctt
gacgagcaggtgagcaggcttgcgggagcgctggcaggagcgggcatcaaaaagggcgat
gtagtcgcgatctatatgccaatgatcccggaggcgttctacgccatctttgcctgctcc
aagatgggagcggtccacactacaatcttttcagggttctctgcgcaggcgctccgctcc
aggctcattgattcaaatgcgaaattgctgataactgcagacactgtcagtcggcggggc
aaagaaatccatctcgcaggccagtggcaaaaagccgtgcagggcacaaaagttagaagg
ataatcacggtcggccgcgactaccaggactttgtgaagagtgcgccaagggccaagaca
gaggtgatggacgcagaagatccgcttttcatcctctatacgtccggcaccaccggcgag
cccaagggcacgctgcaggtgcacggcggctttactgtggtcgcggcgcagcagaccgcg
taccttattgacatgaagcctgacgacgtgctgttctggtatgcagacattggctggata
acgggtcaggtctgggtggtctatggcagcccgataattggcgggaccgcgcttgtctat
gacaacacgctggactaccccacagcagatgcgtggtgcaggctcatcgaagaccacaag
gtaagcatctttggcgcggcgcctacggcgatcaggctgtttatgaaaaaaaacgtgcag
gccggcaactacgatttttcgtcgctccgcgttctggcggcgacaggcgagccgataaac
gccgaggcatggcagtggtactttgaaaacgtggggaagaagcgatgtcctgtcataaac
ctgtccggcggcacggaaatcggcggtgcgatactgagcgcgctgcctgtgatgccgctc
aaagagtgcacggtcgggtgccagatacccggctttgatgcagacgtttttgacgactcg
ggcaagagggcaagcgaaggctacctagtcatcaaaaagccgtggccctccatgacgcgg
gggctcttgaacaaccctggcaggttcatagacacctactggtcaaagtacaaggacgtc
tggtatcacggcgacattgtgcttgtcgatccagacgggctgtggtacatgcgggggcgc
gccgacgacgtcataaaggtggcgggccacaggatcgggactgcagaggttgaggcggca
gccgcgtcgcatccggcggtcgcagaggcggtggctgtcggcaggcccgacgagctcaaa
ggcgaggcgatagtggtgtgcgtcgtggtaaaggacgacggcagccatagcacgaatggc
aacaataacaacaacttgaagcaagagatcatcaggtgtgtggaaggatcgataggaaag
ttcgcccggcctgaagaagtgaggatagtggccgagctaccaaagaccagaaccggcaag
cttgtgaggcggctggtcagggcaaaggttgccggcgagaatatcgccagccaagatttg
tcaactgtagagaacccgtggtcgctagacggcatctag

DBGET integrated database retrieval system