KEGG   Nannochloropsis gaditana: NGA_0119100Help
Entry
NGA_0119100       CDS       T02917                                 

Definition
cytochrome-b5 reductase (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ngd  Nannochloropsis gaditana
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ngd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NGA_0119100
Enzymes [BR:ngd01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     NGA_0119100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 302 aa AA seqDB search
RHRRGSTVSHTLETSCRTREEKRGKVSQRVHCEDRDSTVMDQVAPFLQLVEREELTHNTR
RFRFALQSPQHVLGLPVGQHVSLKYTDSEGKDVTRSYTPISSDDDLGYVDFAIKVYFANT
HPKFPEGGKMSQHLEALQLGDSILMRGPKGSLTYQGRGHFALKSRGALSSRTVSKVGMIA
GGTGITPMLQIIREMLKDKGDKTKVWLLYANQTENDILLQEELEEIAQHHPDRFKLYYTL
DRPPTKWKQGIGFVTSDMIKNNLPPPSSSSFYLVCGPPAMLKLAVIPAFEKEGIAENQYY
TY
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
aggcacagacgcggttcgacagtctcgcacacactagagacctcctgccggacccgcgag
gagaagaggggaaaagtgagtcaaagggtccactgtgaagacagggacagcacagttatg
gatcaagtcgcaccatttcttcagctcgtcgagcgcgaggaactgacccacaacacccgc
cgctttcgcttcgccctccagtcgccccagcatgtgctgggtctgcccgtgggccagcac
gtctccctcaagtacacggacagcgaggggaaggatgtgacacgctcctacacgcccatc
tcctccgacgacgacctcggctacgtggacttcgccatcaaggtctacttcgccaacact
caccccaagttcccggaaggcggcaagatgagccagcacttggaggccctccagctcggt
gactcgatcctcatgcgaggccccaagggctccctcacgtaccagggtcgcggccacttt
gctctcaagagtcgcggggcgctcagctcaagaacggtatccaaggtggggatgatcgcg
ggcgggacgggcatcacgcccatgctgcagatcatccgcgaaatgctcaaggataagggc
gacaagaccaaggtctggctgctctatgccaaccagacggagaacgacatactgctgcag
gaggagcttgaagagatcgcgcaacatcaccccgacagatttaagctctactatacgcta
gacaggccgcccaccaagtggaagcaagggataggcttcgtcacgtctgatatgatcaag
aacaatctacccccaccctcctcttcttccttttaccttgtttgcggccctccggccatg
ctcaagctggccgttatccccgccttcgagaaagagggcattgcagagaatcagtactac
acctactag

DBGET integrated database retrieval system