KEGG   Nannochloropsis gaditana: NGA_0211700Help
Entry
NGA_0211700       CDS       T02917                                 

Gene name
GADB
Definition
glutamate decarboxylase (EC:4.1.1.15)
Orthology
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
ngd  Nannochloropsis gaditana
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ngd00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    NGA_0211700 (GADB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NGA_0211700 (GADB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NGA_0211700 (GADB)
   00430 Taurine and hypotaurine metabolism
    NGA_0211700 (GADB)
Enzymes [BR:ngd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     NGA_0211700 (GADB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 200 aa AA seqDB search
MRKSVPKYRMPDAPLPANVVKTLIDDEMVLDGTPRMNLATFVTTYMEKECEDLMMEAARK
NYIDIDEYPQTYEIQKRCVNILSHLWNAPLGAEEEGTGTSTVGSSEAIMLAVLNMKWAWR
KKRIAQGKPHDKPNLVCGANVQVCWEKAMRYFEVEERLADVSPDCLVLTAERAKALIDEN
TIGVCPILGSTFNGEYEDVQ
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcggaaatctgttcctaagtaccgcatgcctgatgctcctttgcccgccaacgtggtg
aagaccttgattgacgatgagatggtcctggatgggacgccacgcatgaatctggccacg
tttgtgacgacgtacatggagaaggaatgcgaggacctcatgatggaggccgccaggaag
aattatatcgatattgacgagtaccctcaaacgtacgagatccagaagcggtgcgtgaac
attctttcgcacctctggaacgcacctttgggagcggaggaagagggcacgggcacgtcc
acggtgggctcgtccgaggccattatgttggcggtcctcaacatgaaatgggcctggcga
aagaagcgcatcgcacaggggaaaccgcatgacaagccgaatttggtgtgcggggccaac
gtgcaagtatgctgggagaaagccatgcgctatttcgaggtggaagaacgcttggccgac
gtgtctccggattgcttggttctgacggcggagcgcgcgaaggctctgatcgatgagaat
acgatcggcgtgtgtcccatcctggggagtaccttcaatggggaatacgaggatgtccag

DBGET integrated database retrieval system