KEGG   Nannochloropsis gaditana: NGA_0339502Help
Entry
NGA_0339502       CDS       T02917                                 

Gene name
PHOD
Definition
alkaline phosphatase D (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
ngd  Nannochloropsis gaditana
Pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NGA_0339502 (PHOD)
Enzymes [BR:ngd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     NGA_0339502 (PHOD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 364 aa AA seqDB search
MAAAVMSSRMPGLMLVLSIFSTFMLQEHLFSLAEEQGDTMKQMAAEFDGHYENQTLTRVA
FGSCNKQWRTNVLWDNIVDFHPQAYLWLGDAVYVKEKEGDNDANLRRAYSRQLKNKGYQR
LLSSGAIVEGVYDDHDMSTNDGHKVNYTPQRQSAYLDFLGHISEDSPRRSRLGLFSAHVF
GEPPRQVKIIFLDVRSLSDEPAIVVPECVANLLWPVKPYLLALTRWAAVLLGITGRFHGD
MLGTEQWSWLEAQLAGSEASFHVLVSTVQVLSVNPIAEGWGHYPAAQSRLLALLRKHRPR
GLVILSGDVHFAELLVTQPPSEGMREEEKEGKKEALEVTSSGMTHTCFATTMVFSGALIM
EPLS
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcagccgcagtgatgtcatcacgaatgcctggtctgatgctcgttttgagtatattt
tccacttttatgttgcaagagcatctgttcagtctcgctgaggaacaaggtgacacaatg
aagcagatggctgcagagttcgatgggcactacgaaaatcagacgctgactcgagtagca
tttggctcttgcaacaaacagtggcggaccaatgttttatgggacaatattgtggacttc
catcctcaagcgtatctgtggctgggtgacgccgtgtacgtcaaagaaaaggaaggtgac
aatgacgccaaccttcggagagcctactcccgccagctgaaaaataaaggctaccaacga
ctgctgagctcgggtgcaatagtcgaaggcgtatatgatgatcatgacatgtctacgaat
gatggccataaagtgaattatacccctcaacgccagagtgcttatttagacttccttgga
catatttctgaagattctcccagacgatctcggttgggattgttttccgctcacgtcttt
ggagagccaccgcgccaagttaaaatcattttcctggacgtccgctccttgagcgacgag
ccagccattgtggtaccagagtgtgtagctaatcttttatggcctgtgaagccctatctt
ttagcgcttacgcgatgggctgccgtcctcctgggcatcaccggacgctttcacggcgac
atgctggggaccgagcagtggtcatggctggaggcacaactggcaggctcagaggcctct
tttcacgtccttgtctctaccgttcaggtcttatctgtgaatcccattgcggaggggtgg
ggccactacccggccgcacaaagtcggttgcttgcacttttgcggaagcatcggccccgc
ggattggttatcctctccggggatgtacactttgcagaacttctcgtgacgcaaccacct
agtgaagggatgagagaagaggagaaggaggggaagaaggaggccctggaggtaacaagc
agcggaatgacccatacgtgcttcgccaccaccatggttttttcgggggccttaattatg
gaaccattgagctag

DBGET integrated database retrieval system